KEGG   Sus scrofa (pig): 100155574
Entry
100155574         CDS       T01009                                 

Gene name
ADD3
Definition
(RefSeq) gamma-adducin isoform X1
  KO
K18622  adducin
Organism
ssc  Sus scrofa (pig)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ssc04812]
    100155574 (ADD3)
Cytoskeleton proteins [BR:ssc04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     100155574 (ADD3)
SSDB
Motif
Pfam: Aldolase_II
Other DBs
NCBI-GeneID: 100155574
NCBI-ProteinID: XP_001924773
Ensembl: ENSSSCG00000010621
UniProt: A0A4X1TEQ8 A0A287AQ41
Position
14
AA seq 706 aa
MSSDASQGVVTTPPPPSMPHKERYFDRINENDPEYIRERNMSPDLRQDFNMMEQRKRVTQ
ILQSPAFREDLECLIQEQMKKGHNPTGLLALQQIADYIMANSFSGFTSPPLSLGMVTPIN
DLPGADTSSYVKGEKLTRCKLASLYRLADLFGWAHLANTYISVRISKEQDHIIIIPRGLS
FSEATASNLVKVNIIGEVVDQGSTNLKIDHTGFSPHAAIYSTRPDVKCVIHVHTLATAAV
SSMKCGILPISQESLILGDVAYYDYQGSLDEQEERIQLQKVLGPSCKVLVLRNHGVVALG
ETVEEAFHYIFNVQIACEIQVQALAGAGGVDNLLVLDLQKYKAFTHSVAASGGGGVNMGS
HQKWKIGELEFEGLMRTLDNLGYRTGYAYRHPLIREKPRHKSDVEIPATVTAFSFEDDTV
PLSPLKYMAQRQQREKTRWLNSPNTYMKVNVPEESRNGETSPRTKITWMKAEDSSKVSSG
TPIKIEDPNQFVPLNTNPNEVLEKRNKIREQNRYDLKTAGPQSQLLAGIVVDKPPSTMQF
EDDDHAPPAPPNPFSHLTEGELEEYKKTIERKQQGLEDAEQDLLSDDASSVSQIQSQTQS
PQNIPEKLEENHELFSKSFISMDVPVLIVNGKDDVHGIEDELAQRVSRLTTSTTIENIEI
TIKSPEKIEEVPSPEGSPSKSPSKKKKKFRTPSFLKKNKKKEKVEA
NT seq 2121 nt   +upstreamnt  +downstreamnt
atgagttcagatgctagccaaggtgtggttactactcctcctcctcccagcatgcctcac
aaagagaggtattttgaccgtatcaatgaaaatgacccagaatacataagggagaggaac
atgtctcctgatctacgacaagacttcaatatgatggagcaaaggaaacgagttactcaa
atcttgcaaagtccggcctttcgggaagacctggaatgcctaattcaggaacagatgaag
aaaggccacaatccaactggattactagcattacaacagattgcagattacatcatggcc
aattctttttcgggctttacttcacctcccctcagtctcggcatggtcacacctatcaat
gaccttcctggggcagatacatcctcatacgtgaagggagaaaagcttactcgttgtaaa
cttgccagcctgtacagacttgcagacttgtttggatgggcccacctggcaaatacatat
atctcagtaagaataagtaaggagcaagaccacataataataattcccagaggtctgtca
ttttctgaagccacagcctccaatttggtgaaagtcaatatcataggagaagtagtggat
cagggaagtactaatttaaaaattgaccatacaggattcagtccccatgctgcaatctac
tcaacacgtcctgatgttaagtgcgtgatacacgtccatacccttgcaacagcagctgta
tcctccatgaagtgtgggatccttccaatttctcaagagtccctgatcctgggagatgtc
gcctattatgactaccaagggtcactcgatgaacaagaggagagaattcaactgcagaaa
gttctgggaccaagttgtaaggtgctggtactcagaaatcatggtgtggtagcccttggg
gaaacagttgaggaggcttttcattatatttttaatgtgcagatagcctgtgagattcag
gtgcaggcattggcaggagcaggtggtgtagacaatctacttgtattggatcttcagaaa
tacaaagctttcactcacagtgtagcagcatctggaggaggaggagtgaatatgggttcc
catcaaaaatggaagattggcgagcttgagtttgaagggctgatgaggactctggacaat
ttgggatatagaacaggctatgcttataggcatcctctcattcgagaaaagcctaggcac
aagagtgatgtggaaatcccagcaactgtgactgccttttccttcgaagatgatacagtg
ccactctctcctctcaagtacatggcgcagaggcagcagcgtgaaaaaacaagatggctg
aactccccaaatacctacatgaaagtgaatgtgcctgaggagtcccggaatggggaaacc
agtcccaggaccaaaatcacatggatgaaagcggaggactcttccaaagttagtagtgga
acacctatcaaaattgaagatccaaatcagtttgttcctttaaacacaaacccgaacgag
gtactagaaaagaggaataagattcgtgagcaaaatcggtatgacttgaaaacagcagga
ccacagtctcagttgcttgccggaattgttgtggacaagcctccttctaccatgcagttt
gaagatgatgatcatgcccccccggcccctcccaaccccttcagtcatctcacagaagga
gaacttgaagagtataagaagacaatcgagcgtaaacagcaaggcctggaagatgctgag
caggatttactctcagatgacgcttcatctgtttcacaaattcagtctcaaactcagtca
ccgcaaaatatccccgaaaaattagaagaaaaccatgagctattttccaagagcttcatc
tccatggatgtgcctgtcctgatagtaaacggcaaggatgacgtgcatggcattgaagat
gagcttgcccagcgagtgagtaggttaacaacaagcaccaccatagagaacatcgagatc
accattaagtctccagaaaaaattgaagaagtcccatcacctgaaggctcaccttcaaaa
tcaccatccaagaaaaagaagaaattccgcactccttcttttctgaaaaagaacaaaaaa
aaggagaaagttgaagcctaa

DBGET integrated database retrieval system