KEGG   Sus scrofa (pig): 100155855
Entry
100155855         CDS       T01009                                 

Gene name
SNRPF
Definition
(RefSeq) small nuclear ribonucleoprotein F
  KO
K11098  small nuclear ribonucleoprotein F
Organism
ssc  Sus scrofa (pig)
Pathway
ssc03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    100155855 (SNRPF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ssc03041]
    100155855 (SNRPF)
   03032 DNA replication proteins [BR:ssc03032]
    100155855 (SNRPF)
Spliceosome [BR:ssc03041]
 Complex A
  U1 snRNP components
   Sm proteins
    100155855 (SNRPF)
  U2 snRNP components
    100155855 (SNRPF)
 Complex B
  U1 snRNP components
    100155855 (SNRPF)
  U4/U6.U5 tri-snRNP components
    100155855 (SNRPF)
 Complex C
  U2 snRNP components
    100155855 (SNRPF)
DNA replication proteins [BR:ssc03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Telomerase complex (fungi)
    Sm core complex
     100155855 (SNRPF)
SSDB
Motif
Pfam: LSM SM-ATX
Other DBs
NCBI-GeneID: 100155855
NCBI-ProteinID: NP_001177142
Ensembl: ENSSSCG00000000895
UniProt: F1SQR4 A0A4X1SJX5
Position
5
AA seq 86 aa
MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLG
EVLIRCNNVLYIRGVEEEEEDGEMRE
NT seq 261 nt   +upstreamnt  +downstreamnt
atgagtttgcctctcaatcccaaacctttcctcaatgggttaacagggaagccagtgatg
gtgaaacttaagtggggaatggagtacaaaggctacctggtgtctgtagatggctatatg
aatatgcagcttgcaaacacagaagaatacatagatggagcattgtctggacatctgggt
gaagttttaataaggtgtaataatgtcctttatatcaggggtgttgaagaagaagaagaa
gatggggaaatgagagaatag

DBGET integrated database retrieval system