KEGG   Sus scrofa (pig): 100155956
Entry
100155956         CDS       T01009                                 

Gene name
PTGES3
Definition
(RefSeq) prostaglandin E synthase 3 isoform X1
  KO
K15730  cytosolic prostaglandin-E synthase [EC:5.3.99.3]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00590  Arachidonic acid metabolism
ssc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    100155956 (PTGES3)
Enzymes [BR:ssc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.99  Other intramolecular oxidoreductases
    5.3.99.3  prostaglandin-E synthase
     100155956 (PTGES3)
SSDB
Motif
Pfam: CS
Other DBs
NCBI-GeneID: 100155956
NCBI-ProteinID: XP_001929448
Ensembl: ENSSSCG00000000406
Vega: OTTSUSG00000000798
UniProt: F1SL99
Position
5
AA seq 160 aa
MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCID
PNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNF
DRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE
NT seq 483 nt   +upstreamnt  +downstreamnt
atgcagcctgcttctgcaaagtggtacgatcgaagggactatgtcttcattgaattttgt
gttgaagacagtaaagatgttaatgtaaattttgaaaagtccaagcttacattcagttgt
cttggaggaagtgataattttaaacatttaaatgaaattgatctttttcactgtattgat
ccaaatgattccaagcataaaagaacggacagatcaattttatgttgtttacgaaaagga
gaatctggccagtcatggccacggttaacaaaagaaagggcgaagcttaattggcttagt
gtggacttcaataattggaaagactgggaagatgactcagatgaagacatgtctaatttt
gatcgtttctctgagatgatgaacaacatgggtggtgatgaggatgtagatttaccagaa
gtagatggagcagatgatgattcacaagacagtgatgatgaaaaaatgccagatctggag
taa

DBGET integrated database retrieval system