KEGG   Sus scrofa (pig): 100156029
Entry
100156029         CDS       T01009                                 

Gene name
GPC4
Definition
(RefSeq) glypican-4
  KO
K08110  glypican 4
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100156029 (GPC4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:ssc00535]
    100156029 (GPC4)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ssc00537]
    100156029 (GPC4)
Proteoglycans [BR:ssc00535]
 Cell surface proteoglycans
  Glypican family (GPI-anchored HSPG)
   100156029 (GPC4)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ssc00537]
 Others
  100156029 (GPC4)
SSDB
Motif
Pfam: Glypican DUF1910 Corona_6B_7B DUF5082
Other DBs
NCBI-GeneID: 100156029
NCBI-ProteinID: XP_001925506
Ensembl: ENSSSCG00000012679
Vega: OTTSUSG00000004880
UniProt: F1RTE1 A0A4X1WA83
Position
X
AA seq 556 aa
MARFGLPALLCTLAALSAALLAAEPKSKSCSEVRRLYVSKGFDKNDAPTHEINGDHLKIC
PQGYTCCSQEMEEKYSLQSKDDFKSVVSEQCNHLQAVFASRYKKFDEFFKELLENAEKSL
NDMFVKTYGHLYMQNSELFKDLFEELKRYYVAGNVNLEEMLQDFWARLLERMFRLVNSQY
HFTDEYLECVSKYTEQLKPFGDVPRKLKLQVTRAFVAARTFAQGLAVARDVVSKVSVVNP
TAQCTHALLKMIYCSHCQGLVTVKPCYNYCSNIMRGCLANQGDLDFEWNNFIDAMLMVAE
RLEGPFNIESVMDPIDVKISDAIMNMQENSVQVSQKVFQGCGPPKPLPAGRLSRSISEGA
FSARFRPFHPEERPTTAAGTSLDRLVTDVKEKLKQAKKFWSSLPSNVCNDERMAAGNGNE
DDCWNGKGKSRYLFAVTGNGLANQGNNPEVQVDTSKPDILILRQIMALRVMTSKMKNAYN
GNDVDFFDISDESSGEGSGSGCEYQQCPSEFEYNATEHSGKNAHDKASSAGAPARAQPYL
LTAFGILSLVMPREWR
NT seq 1671 nt   +upstreamnt  +downstreamnt
atggcacggttcggcttgcccgcgctgctctgcaccctggccgcgctcagcgccgcgctg
ctggctgccgagcccaagtcgaaaagttgctcggaagtgagacgtctctacgtgtccaaa
ggcttcgacaagaacgatgcccccacgcacgagatcaacggggatcatttgaagatctgt
ccccagggttacacctgctgctctcaagagatggaggagaaatacagcctgcaaagtaag
gatgatttcaaaagtgtggtcagcgaacagtgcaaccatttgcaagccgtctttgcttcc
cgttacaagaagtttgatgaattctttaaagaactgcttgaaaatgcggagaagtccctg
aatgacatgttcgtgaagacctacggccacttatacatgcaaaactccgagctgttcaag
gatctcttcgaggagttgaagcgctactacgtggcgggcaacgtcaacctggaggagatg
ctccaggacttctgggcccgcctcctggagcgcatgttccgcctggtgaactcccagtac
cacttcaccgacgagtatctggaatgcgtgagcaagtacacggagcagctgaagcccttt
ggagatgtccctcgaaaactgaagctccaggtcactcgtgcgtttgtagcagcccggacc
tttgctcagggcttagccgtcgcaagagatgtagtgagcaaagtctccgtggtcaatccc
acagcccagtgtacccacgccctgctgaagatgatctactgctcccattgccaaggtctc
gtgaccgtgaaaccgtgttacaactactgctccaacatcatgagaggctgtctggccaac
caaggggatctggatttcgagtggaacaatttcatagatgctatgctgatggtggccgag
aggctggagggtcctttcaacattgagtctgtcatggatcccatcgacgtgaagatttct
gatgccatcatgaacatgcaggagaacagcgtacaggtgtctcaaaaggtgttccagggc
tgtggcccccccaaacccctgccggctggccgcctctcccgctccatctccgaaggtgcc
ttcagcgcccgcttcaggccatttcaccccgaggagcgcccgaccacggcagccggcacc
agtttggaccgactggttactgatgtcaaggagaagctgaaacaggccaagaagttctgg
tcctctcttcccagcaacgtctgcaatgacgagaggatggctgcaggcaatggcaatgag
gacgactgctggaatggaaaaggcaaaagcaggtacctgtttgcagtgacaggaaatgga
ttagccaaccagggcaacaatccagaggtccaggtcgacaccagcaaaccagacatactg
atccttcgtcaaatcatggctcttcgagttatgaccagcaaaatgaagaatgcttacaat
gggaacgacgtggacttctttgatatcagtgatgaaagcagtggagaaggaagtgggagt
ggctgtgagtatcagcagtgcccttcggagtttgagtataatgcaactgagcactctggg
aagaatgcccatgataaagccagcagcgctggggcccctgccagggcccagccctacctc
ctcactgcctttggcatcttgtccctggtcatgccgagagagtggagataa

DBGET integrated database retrieval system