KEGG   Sus scrofa (pig): 100156435
Entry
100156435         CDS       T01009                                 

Gene name
TNNC1
Definition
(RefSeq) troponin C, slow skeletal and cardiac muscles
  KO
K05865  troponin C, slow skeletal and cardiac muscles
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04020  Calcium signaling pathway
ssc04260  Cardiac muscle contraction
ssc04261  Adrenergic signaling in cardiomyocytes
ssc05410  Hypertrophic cardiomyopathy
ssc05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100156435 (TNNC1)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100156435 (TNNC1)
   04261 Adrenergic signaling in cardiomyocytes
    100156435 (TNNC1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100156435 (TNNC1)
   05414 Dilated cardiomyopathy
    100156435 (TNNC1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ssc04812]
    100156435 (TNNC1)
Cytoskeleton proteins [BR:ssc04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Troponins
     100156435 (TNNC1)
SSDB
Motif
Pfam: EF-hand_7 EF-hand_8 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_9 EF-hand_4 SPARC_Ca_bdg DUF5580 EMG1 Dak2
Other DBs
NCBI-GeneID: 100156435
NCBI-ProteinID: NP_001123715
Ensembl: ENSSSCG00000011441
UniProt: P63317
Position
13
AA seq 161 aa
MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEM
IDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLEELKIM
LQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
NT seq 486 nt   +upstreamnt  +downstreamnt
atggatgacatctacaaggctgcggtagagcagctgacagaagagcagaaaaatgagttc
aaggcagcctttgacatcttcgtgctgggcgccgaggatggctgcattagcaccaaggag
ctgggcaaagtgatgaggatgctgggccagaaccccacacctgaggaactgcaggagatg
attgacgaggtggatgaagacgggagtggcacagtggacttcgatgagttcttggtcatg
atggttcggtgcatgaaggatgacagcaaaggaaagtctgaggaggagctttctgacctc
ttccgcatgtttgacaaaaacgctgatggctatatcgacctggaggagctgaagataatg
cttcaggcgacaggcgagaccatcacagaggatgacatcgaggagctcatgaaagatggt
gacaagaacaatgatggccgcattgactatgacgaattcctggagttcatgaagggggtg
gagtaa

DBGET integrated database retrieval system