KEGG   Sus scrofa (pig): 100156513
Entry
100156513         CDS       T01009                                 

Gene name
NCBP2
Definition
(RefSeq) nuclear cap-binding protein subunit 2
  KO
K12883  nuclear cap-binding protein subunit 2
Organism
ssc  Sus scrofa (pig)
Pathway
ssc03013  RNA transport
ssc03015  mRNA surveillance pathway
ssc03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    100156513 (NCBP2)
  09122 Translation
   03013 RNA transport
    100156513 (NCBP2)
   03015 mRNA surveillance pathway
    100156513 (NCBP2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ssc03019]
    100156513 (NCBP2)
   03041 Spliceosome [BR:ssc03041]
    100156513 (NCBP2)
Messenger RNA biogenesis [BR:ssc03019]
 Eukaryotic type
  mRNA processing factors
   5' end processing
    Cap binding complex
     100156513 (NCBP2)
Spliceosome [BR:ssc03041]
 Common components
  Common spliceosomal components
   Cap binding complex
    100156513 (NCBP2)
SSDB
Motif
Pfam: RRM_1 RRM_occluded RRM_5
Other DBs
NCBI-GeneID: 100156513
NCBI-ProteinID: XP_003358812
Ensembl: ENSSSCG00000027323
Vega: OTTSUSG00000003543
UniProt: F2Z5Q9 A0A4X1TVZ8
Position
13
AA seq 156 aa
MSGGLLKALRSDSYVELSQYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELF
SKSGDIKKIIMGLDKMKKTACGFCFVEYYSRADAENAMRYINGTRLDDRIIRTDWDAGFK
EGRQYGRGRSGGQVRDEYRQDYDAGRGGYGKLAQNQ
NT seq 471 nt   +upstreamnt  +downstreamnt
atgtcgggtggcctgctgaaggcgctgcgcagcgactcctacgtcgaactgagccagtac
cgggaccagcacttccggggtgacaatgaagaacaggagaagttactgaagaaaagctgt
acattgtatgttggaaatctttccttttatacaactgaagaacaaatctatgaactcttc
agcaaaagtggtgacataaagaaaatcatcatgggcctggataaaatgaagaaaacagcg
tgtgggttttgctttgtggaatactattcaagagcagatgctgaaaatgccatgcggtac
ataaatggaactcgtctggatgaccgcatcattcgcacagactgggatgcaggctttaaa
gagggcaggcagtatggccgtggacgatctgggggccaggtacgagatgagtatcgacag
gactatgatgctgggagaggtggctatggaaaattggcccaaaaccagtga

DBGET integrated database retrieval system