KEGG   Sus scrofa (pig): 100156570Help
Entry
100156570         CDS       T01009                                 

Gene name
EIF3A
Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit A
  KO
K03254  translation initiation factor 3 subunit A
Organism
ssc  Sus scrofa (pig)
Pathway
ssc03013  RNA transport
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    100156570 (EIF3A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:ssc03012]
    100156570 (EIF3A)
Translation factors [BR:ssc03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    100156570 (EIF3A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCI
Motif
Other DBs
NCBI-GeneID: 100156570
NCBI-ProteinID: XP_001928377
Ensembl: ENSSSCG00000010679
UniProt: F1S4P6
Position
14
AA seq 1376 aa AA seqDB search
MPAYFQRPENALKRANEFLEVGKKQPALDVLYDVMKSKKHRTWQKIHEPIMLKYLELCVD
LRKSHLAKEGLYQYKNICQQVNIKSLEDVVRAYLKLAEEKTEAAKEESQQMVLDIEDLDN
IQTPESVLLSAVSGEDTQDRTDRLLLTPWVKFLWESYRQCLDLLRNNSRVERLYHDIAQQ
AFKFCLQYTRKAEFRKLCDNLRMHLSQIQRHHNQSTAINLNNPESQSMHLETRLVQLDSA
ISMELWQEAFKAVEDIHGLFSLSKKPPKPQLMANYYNKVSTVFWKSGNALFHASTLHRLY
HLSREMRKNLTQEEMQRMSTRVLLATLSIPITPERTDIARLLDMDGIIVEKQRRLATLLG
LQAPPTRIGLINDMVRFNVLQYVVPEVKDLYNWLEVEFNPLKLCERVTKVLNWIREQPEK
EPELQQYVPQLQNNTILRLLQQVAQIYQSIEFSRLTSLVPFVDAFQLERAIVDAARHCDL
QVRIDHTSRTLSFGSDLNYATREDAPIGPHLQSMPSEQIRNQLTAMSSVLAKALEVIKPA
HILQEKEEQHQLAVTAYLKNSRKEHQRILARRQTIEERKERLESLNIQREKEELEQREAE
LQKVRKAEEERLRQEAKEREKERILQEHEQIKKKTVRERLEQIKKTELGAKAFKDIDIED
LEELDPDFIMAKQVEQLEKEKKELQERLKNQEKKIDYFERAKRLEEIPLIKSAYEEQRIK
DMDLWEQQEEERITTMQLEREKALEHKNRMSRMLEDRDLFVMRLKAARQSVYEEKLKQFE
ERLAEERHNRLEERKRQRKEERRITYYREKEEEEQRRAEEQMLKEREERERAERAKREEE
LREYQERVKKLEEVERKKRQRELEIEERERRREEERRLGEDPLSRKDSRWGDRDSEGTWR
KGPEIDSEWRRGPPEKDWRRGEGRDEERPHRRDDDRPRRLGDDEERESSLRPDEDRGPRR
GMDDDRGPRRGLDEDRFSRRGADDDRPSWRNTDDDRPPRRIGDEDRGSWRHADDDRPPRR
GLDEDRGSWRTADEDRGPRRGMDEDRGPRRGGVDDERSSWRNADDDRPRRGMDDDRGPRR
GMDDDRGPRRGMDDDRGPRRGLDDDRGPWRNTDDDRISRRGADDDRGPWRNMDDDRIPRR
GDDDRIPRRGDDSRPGPWRPFVKPGGWREKERAREESWGPPRESRPSEDREWDREKERDR
DNQDRDENEREPERDRDRERDRERDRDRDGDREDRFRRPRDEGGWRRGPAEESSSWRDAS
RRDDRDRDDRRRDDRRDLRERRDDRDRRGPPLRSEREEVSSWRRADDRKDDRAEERDAPR
RVPPPALSRDRERDRDRDRERDGEKEKTSWRADKDRESLRRTKNETDEDGWTTVRR
NT seq 4131 nt NT seq  +upstreamnt  +downstreamnt
atgccggcctacttccagaggccggaaaatgccctcaaacgcgccaacgaatttcttgag
gttggcaaaaagcaacctgctttggatgttctttatgatgttatgaaaagtaagaaacat
agaacatggcaaaaaatacatgagccaattatgttgaaatacttggagctttgtgtggat
cttcgcaagagccacctggctaaagaaggattataccagtataagaacatttgtcaacag
gtgaacatcaaatctctagaggatgttgttagggcatatttgaaattagcagaggagaaa
actgaagctgctaaagaagaatctcagcagatggtcttagacatagaagatctggataat
attcaaactcctgagagtgttctcctaagtgcagtaagtggtgaagacactcaggatcgt
actgacagattacttttaactccatgggttaaattcctgtgggaatcatacagacagtgt
ttggaccttcttcggaacaattctagagtagagcgtctctaccatgatattgcccaacaa
gctttcaaattctgccttcaatatacccgtaaggccgaattccgtaagctgtgtgacaat
ttgagaatgcacttgtctcagattcaacgccaccataaccaaagtacagcaatcaatctt
aataatccagagagccagtccatgcatttggaaaccaggcttgttcagttggacagtgct
atcagcatggaattgtggcaggaagcattcaaagctgtggaagatattcatgggctgttc
tccttgtctaaaaaaccacccaaacctcagttgatggcaaattactataacaaagtttca
actgtattttggaaatctggaaatgctctttttcatgcatctacactccatcgtctttac
catttatctagagaaatgagaaagaatcttactcaagaagagatgcaaagaatgtctact
agagtccttttggccactctttccatccctattacccctgagcgtactgatatcgctcgg
cttctggatatggacggcattattgttgaaaagcagcgtcgtcttgcaacactgctaggc
ctgcaagccccaccaacgcgaattggccttattaatgatatggtcagattcaatgtgcta
cagtatgttgtcccagaagtaaaagacctttataattggctggaagtcgaatttaaccca
ctaaaactctgtgagagagtcacaaaggttctgaattggattagggaacaacctgaaaag
gaaccagagttacagcagtacgtcccacagctgcaaaacaacaccatccttcggcttctg
cagcaggtggcacaaatttatcagagcattgagttttctcgtttgacttctctggttcct
tttgttgatgctttccaactggaacgggccatagtagatgctgccaggcactgtgacctt
caggttcgtattgaccacacttctcggacccttagctttggatctgatttgaattatgcg
actcgagaagatgctccaattggtcctcatctgcaaagcatgccttcagaacagataaga
aaccagctgacagccatgtcgtcagtacttgcaaaagcacttgaagtcatcaagccagct
catatactgcaagagaaagaagaacagcatcagttggctgttactgcataccttaaaaat
tcacggaaagagcaccagcgtatcctggctcgccggcagacaatagaggaaaggaaagag
cggcttgagagcctgaatattcagcgtgagaaagaagaactggagcagagggaagctgaa
ctccagaaagtgcggaaggctgaagaagagaggctgcgacaggaggcaaaggagagagag
aaggagcgtatcttacaggaacatgagcaaatcaaaaagaaaactgttcgcgagcgtttg
gagcagatcaagaagacagaactgggtgccaaagcattcaaagatattgatattgaagac
cttgaagaactggatccagatttcatcatggctaaacaggttgaacaattggagaaagaa
aaaaaggaacttcaggaacgcctaaagaatcaagaaaaaaagattgactattttgaaaga
gccaaacgtttggaagaaatccctttgataaagagtgcttatgaggaacagagaattaaa
gacatggatctgtgggaacaacaagaagaagaaagaattactacgatgcagctggaacgg
gaaaaggctcttgaacataagaaccgaatgtcacgaatgcttgaagacagagatttattt
gtaatgcgactcaaggcagcacggcagtctgtttatgaggaaaaacttaaacagtttgaa
gagcgattagcagaagaaaggcataatcgcttggaagaacgtaaaaggcaacgtaaagaa
gaacgaagaataacctactacagagaaaaagaagaggaagagcagaggagggccgaagaa
caaatgctgaaagagcgagaagagagagagcgtgctgaacgggcaaagcgtgaggaggaa
cttcgagaataccaggagagggtcaagaagctagaagaagtagaaaggaagaaacgccag
agggaattggaaattgaagagagggaacgtcgtagagaggaggaaagaagacttggcgaa
gatccactttctagaaaggactctcgttggggagatagagattcagagggcacatggaga
aaaggacctgaaatagattctgagtggagaagaggcccaccggaaaaagattggagacgt
ggagaagggcgggatgaagagaggcctcacagaagagacgatgatcggccaaggcgtttg
ggggatgacgaagagagagagtcctccctcagaccagacgaagatcggggtccgcggcgg
ggcatggatgatgaccgaggcccaagacgtggtcttgatgaagatcggttctctcgccga
ggggcagacgatgaccggccttcctggcgtaacacagacgacgacaggcctcccagaaga
atcggtgatgaagacaggggaagctggcgtcatgcagatgacgacagaccacctagacga
ggactggacgaggacagaggaagctggcgaacagctgatgaggacagaggacccagacgt
gggatggacgaggaccgggggcctcggcgaggaggtgtggatgatgagcggtcatcctgg
cggaatgctgacgacgatcgtccccggcggggcatggatgatgaccggggtccccggcgg
ggcatggatgatgaccggggtcccaggaggggcatggatgatgaccggggtcccaggcga
gggttggatgacgatcgaggaccttggaggaataccgatgatgatagaatttccaggcgc
ggtgcagatgatgacagggggccttggagaaacatggatgacgatcggattcccaggagg
ggtgacgacgatcggattcccaggaggggtgatgactcaagacctggtccctggagaccc
tttgtcaagccaggtggatggagagagaaagaaagagccagagaagaaagttggggtcca
cctcgggaatccagaccctcagaagaccgtgaatgggatagggaaaaagagagagaccga
gataatcaagatcgtgatgagaacgaaagggagcctgagcgggacagagacagagagagg
gacagagagagggacagagacagagatggggatcgagaggatcgcttcagacgaccaagg
gatgaaggtggctggagaagaggaccagctgaggaatcctcaagctggagagatgcgagt
cgtcgtgacgatagggatcgagatgaccgccgtcgtgatgatcgccgagatctaagagaa
agacgagatgaccgagaccgaagagggcctcctctcagatcagagcgcgaggaagtaagt
tcttggagacgcgctgatgacaggaaggatgaccgggcggaagagcgggatgcccctcgt
cgagttcctcccccagctctttcgagagatcgagaaagagatcgagatcgagaccgagaa
agagacggtgaaaaagagaagacctcctggagagctgacaaagatagggagtctctccgt
cgtactaaaaatgagactgatgaggatgggtggaccacagtacgacgctaa

DBGET integrated database retrieval system