KEGG   Sus scrofa (pig): 100156882
Entry
100156882         CDS       T01009                                 

Gene name
FURIN
Definition
(RefSeq) furin isoform X2
  KO
K01349  furin [EC:3.4.21.75]
Organism
ssc  Sus scrofa (pig)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ssc01002]
    100156882 (FURIN)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ssc03110]
    100156882 (FURIN)
   04131 Membrane trafficking [BR:ssc04131]
    100156882 (FURIN)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.75  furin
     100156882 (FURIN)
Peptidases and inhibitors [BR:ssc01002]
 Serine peptidases
  Family S8: subtilisin family
   100156882 (FURIN)
Chaperones and folding catalysts [BR:ssc03110]
 Intramolecular chaperones
  Subtilisin family
   100156882 (FURIN)
Membrane trafficking [BR:ssc04131]
 Endosome - Golgi transport
  Others
   Others
    100156882 (FURIN)
SSDB
Motif
Pfam: Peptidase_S8 P_proprotein S8_pro-domain Furin-like_2 VSP PRIMA1 DUF357
Other DBs
NCBI-GeneID: 100156882
NCBI-ProteinID: XP_001929382
Ensembl: ENSSSCG00000001817
UniProt: F1RMJ1
Position
7
AA seq 797 aa
MELRPWLLWVVAAAGALVLLAADARGQKVFTNTWAVHIPGGPAVADRVARKHGFVNLGQI
FGDYYHFWHRAVTKRSLSPHRLRHSRLQREPQIQWLEQQVAKRRTKRDVYLEPTDPKFPQ
QWYLSGVTQRDLNVKEAWAQGYTGRGIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQDP
DPQPRYTQMNDNRHGTRCAGEVAAVANNGVCGVGVAYNARIGGVRMLDGEVTDAVEARSL
GLNPNHIHIYSASWGPEDDGKTVDGPARLAEEAFFRGVSQGRGGLGSIFVWASGNGGREH
DSCNCDGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGNQNEKQIVTTDLRQKC
TESHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLVVQTSKPAHLNANDWTTNGVGRKV
SHSYGYGLLDAGAMVALAQNWTTVDPQRKCIIDILTEPKDIGKRLEVRKTVTACLGEPSH
ITRLEHAQARLTLSYNRRGDLAIHLVSPMGTRSTLLAARPHDYSADGFNDWAFMTTHSWD
EDPSGEWVLEVENTSEANNYGTLTKFTLVLYGTAPEGLPTPPESIGCKTLTSGQACVVCE
EGFSLHQKTCVQHCPPGFAPQVLDTHYNTENDVEIIRASVCVPCHASCATCQGPAPTDCL
TCPSHASLDPVEQTCSRQSQSSRESPPQQLPRPPPPSPQEEEAEPRVRAGQLPSHLPEVV
AGLICALIVLVFVTVFLVLQLRSGFSFRGVKVYTMDRGLISYKGLPPEAWQEECPSDSEE
DEGRGERTAFIKDQSAL
NT seq 2394 nt   +upstreamnt  +downstreamnt
atggagctgaggccctggttgctatgggtggtagcagcagcaggagccttggtcctgctg
gcggccgatgcccgtggccagaaagtcttcaccaacacctgggctgtgcacattcctgga
ggtccagctgtggctgacagagtggcacgcaagcatggcttcgtcaacttgggccagatc
ttcggcgactattaccacttctggcatcgagcagtgacaaagcggtccctgtcgcctcac
cgcctgcggcacagccggctgcagcgggagcctcaaatacagtggctagagcagcaggtg
gcaaagcgacggaccaaacgggacgtgtacctggagcccacggaccctaagtttccccag
cagtggtacctgtctggcgtcacccagcgggacctgaacgtgaaggaggcctgggcccag
ggctacacggggcgtggcattgtggtctccattctggatgatggcattgagaagaaccac
ccggacttggcaggcaattatgaccctggggccagcttcgatgtcaacgaccaggacccg
gacccccagcctcggtacacacagatgaatgacaacaggcatggcacacggtgtgcgggt
gaggtggctgcggtggccaacaacggtgtctgtggcgtaggtgtggcctacaatgcccgc
attggaggggtgcgcatgctggacggcgaagtgacagatgcagtggaggcccgctcgctg
ggcctgaaccccaaccacatccacatctacagcgccagctggggccctgaggacgatggc
aagaccgtggacgggccagcccgccttgctgaggaggccttcttccggggggtcagccag
ggccgtggaggactaggctccatctttgtctgggcctcggggaatgggggccgggagcat
gacagctgcaactgcgatggctacaccaacagcatctacacgctgtccatcagcagcgcc
acgcaatttggcaacgtaccctggtacagtgaggcctgctcgtctacactggccacgacc
tacagcagcggcaaccagaacgagaagcagatagtgaccaccgatctgcggcagaagtgt
acggagtctcacacaggcacctctgcctctgcccccttggcagcgggcatcatcgctctc
accctggaggccaataagaacctcacatggcgggacatgcagcatctggtggtacagacc
tcaaagccagcccacctcaacgctaatgactggaccaccaatggcgtgggccgcaaagtg
agccattcgtacggctacgggttattggacgcaggtgccatggtggccctggcccagaac
tggaccacggtggacccccagcgcaagtgcatcattgacatcctcactgagcccaaggac
atcgggaagcggctggaggtgcggaagacagtgaccgcctgcctgggggaacccagccac
atcacgcggctggagcatgctcaggcgcggctcaccctgtcctacaatcgccgcggtgac
ctggccatccacctggtcagccccatgggcacccgatccaccctgctggctgccaggccg
cacgactactcggcagacggatttaacgactgggccttcatgacgacccactcctgggat
gaggacccttctggcgagtgggtcctggaggtcgaaaacaccagtgaagccaacaactat
gggacgctgaccaagttcaccctcgtgctgtacggcacggcccccgaggggctgcccaca
cctcccgagagcatcggctgcaagaccctcacatccggccaggcctgtgtggtgtgcgag
gagggcttctccctgcaccagaagacctgtgtccagcactgccctcccggcttcgctccc
caagtcctcgacacacactataacactgagaacgacgtggagatcatccgggccagcgtc
tgtgtcccctgccatgcctcgtgtgccacgtgccaggggccagcccccacggactgcctc
acctgccccagccacgcatccctggaccccgtggagcagacgtgctcccggcaaagccag
agcagccgcgagtccccaccgcagcagctgccccggccgcccccgccctccccacaggag
gaggaggcagaacctcgggtgcgggcggggcagctgccctcacacctgcccgaggtggtg
gccggcctcatctgcgccctcatcgtgctggtcttcgtcactgtcttcctggtcctgcag
ctgcgctcgggcttcagcttccggggggtgaaggtgtacaccatggaccgtggcctcatc
tcctacaaggggctgccccctgaagcctggcaggaggagtgtccatccgactccgaagag
gacgagggccggggcgagaggaccgcctttatcaaagaccagagcgccctttga

DBGET integrated database retrieval system