KEGG   Sus scrofa (pig): 100156917Help
Entry
100156917         CDS       T01009                                 

Gene name
GALC
Definition
(RefSeq) galactocerebrosidase
  KO
K01202  galactosylceramidase [EC:3.2.1.46]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00600  Sphingolipid metabolism
ssc01100  Metabolic pathways
ssc04142  Lysosome
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    100156917 (GALC)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100156917 (GALC)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.46  galactosylceramidase
     100156917 (GALC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_59 Glyco_hydro_59M Glyco_hydro_30 DUF1080
Motif
Other DBs
NCBI-GeneID: 100156917
NCBI-ProteinID: NP_001230560
Ensembl: ENSSSCG00000027865
Position
7
AA seq 685 aa AA seqDB search
MAERRLQASRQRRVKVMTAAAGSAGQVAVTLLLCALLAPGSSYVLDDSDGLGREFDGIGA
VSGGGATSRLLVNYPEPYRSQILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYA
LDENYFRGYEWWLMKEAKKRNPNITFIGLPWSFPGWLGKGFNWPYVNLQLTAYYVMTWIV
GAKHYHDLDIDYIGIWNERAFDANYIKVLRRMLNYQGLQQVKIIASDNLWEPISASMLLD
SELMKAIDVIGAHYPGTRTVKDARLTEKKLWSSEDFSTLNNDVGAGCWGRILNQNYINGY
MTSTIAWNLVASYYEQLPYGRCGLMTAQEPWSGHYAVEAPIWISAHTTQFTQPGWYYLKT
VGHLEKGGSYVALTDGLGNLTIIVETMSHKHSLCIRPFLPYFNVSHQFATFVLKGSFREI
PELQVWYTKLGKPSKRYLFKQLDSLWLLDSSGSFTLELHEDELFTFTTLTTGNKGSYPPP
PKSQPFPCVYEDDFNVDYPYFSEAPNFADQTGVFEYFMNIEDPGEHRFTLRQVLNQRPIT
WAADAFNTISVIGDYKWSNLTIKCDVYIETSETGGVFIAGRVNKGGILIRSARGVFFWIF
ANGSYQVTGDLAGWIIYTSGYADIKAKKWYTLTLTIKGGSSSGTLNGKLLWKNVSVNFPK
NGWAAIGTHSFEFAQFDNFRVEATC
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atggctgagcgccgactccaggcttcccggcaacgccgggtgaaagtcatgacggctgcc
gcgggttcggcgggccaagtcgcggtgaccctgctgctgtgcgcgctgcttgcgcccggc
agctcgtacgtgctcgacgactctgacgggctgggccgggagttcgacggcatcggagcg
gtcagcggcggcggggcaacctcccgacttctagtaaattacccagagccctatcgttct
caaatactggattatctctttaagccaaacttcggtgcctctttgcatattctaaaagtt
gaaataggtggtgatgggcagacaacagatggcactgagccctcccacatgcactatgca
ttagatgagaattatttccgaggatatgagtggtggttaatgaaggaagctaagaagcgg
aaccctaatattacattcattgggttgccatggtcattccctggatggctggggaaaggt
ttcaactggccttatgtaaatcttcagctgactgcctactatgtcatgacctggattgtg
ggcgccaagcattatcatgatctggatattgattatattgggatttggaatgagagggca
tttgacgccaattatatcaaggtgttaagaagaatgctgaactatcaaggcctccagcaa
gtgaaaatcatagcaagtgataatctctgggagcccatttctgcttctatgctgcttgac
tctgaactcatgaaggcgattgatgtgataggagctcattatcctgggacccgtacagta
aaggatgctaggttgactgagaagaagctttggtcttctgaagattttagcactttgaat
aatgatgtgggtgcaggctgctggggccgcatattgaatcaaaattacatcaatggctac
atgacttccaccattgcttggaatttagtggctagttactatgaacagttgccgtatggg
cgttgtggactgatgactgctcaggagccatggagcgggcactatgcagtagaagctccc
atctggatatcagctcataccactcagtttactcaaccaggttggtattacctgaagaca
gttggccatttagagaaaggaggaagctacgtagccctgactgatggtttaggtaacctc
accatcatcgttgaaactatgagtcataaacattccctatgtataaggccatttcttccc
tatttcaacgtgtcacatcaatttgctaccttcgttcttaaaggttcttttcgtgaaata
ccagagctgcaggtgtggtataccaaacttggaaaaccgtctaagagatatcttttcaaa
caactggattctctatggcttctcgacagcagtggcagtttcacgttagaactgcatgag
gacgagctgttcacattcaccactctcaccactggaaacaaaggcagctacccgccgcct
ccaaagtcccagcccttcccctgtgtctatgaggacgatttcaacgtcgattacccgtat
tttagtgaagctccaaatttcgctgatcagactggcgtgtttgaatattttatgaacatc
gaagaccctggagagcatcgcttcaccctgcgccaggttctcaaccaaagacccatcact
tgggccgctgatgcattcaacaccatcagtgttataggagattacaaatggtccaatctg
actatcaagtgtgatgtgtacatagagacctctgagacgggtggtgtgttcattgccgga
agggtaaataaaggtggtattttgattagaagtgccagaggagttttcttctggattttt
gcaaatggatcctaccaagttacaggtgatctagctggatggatcatatatacttcagga
tatgctgacattaaagcaaaaaaatggtatacactcactttaactattaagggcggttcc
tcctccggcacgctgaatggcaagcttctctggaagaatgtctctgtgaacttcccgaag
aacggctgggccgcaattgggacgcactcctttgaatttgcccagtttgacaacttccgt
gtggaagccacatgctaa

DBGET integrated database retrieval system