KEGG   Sus scrofa (pig): 100157002
Entry
100157002         CDS       T01009                                 

Definition
(RefSeq) vesicle-trafficking protein SEC22b
  KO
K08517  vesicle transport protein SEC22
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04130  SNARE interactions in vesicular transport
ssc04145  Phagosome
ssc05134  Legionellosis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    100157002
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100157002
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    100157002
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ssc04131]
    100157002
Membrane trafficking [BR:ssc04131]
 SNARE
  VAMP, Ykt6, Sec22 (R)
   Sec22
    100157002
SSDB
Motif
Pfam: Longin Synaptobrevin IMD DUF3958 Sec20
Other DBs
NCBI-GeneID: 100157002
NCBI-ProteinID: XP_003484266
Ensembl: ENSSSCG00000020964 ENSSSCG00000021049
UniProt: F1SB09 A0A4X1SNR2
Position
4
AA seq 215 aa
MVLLTMIARVADGLPLAASMQEDEQSGRDLQQYQSQAKQLFRKLNEQSPTRCTLEAGAMT
FHYIIEQGVCYLVLCEAAFPKKLAFAYLEDLHSEFDEQHGKKVPTVSRPYSFIEFDTYIQ
KTKKLYIDSRARRNLGSINTELQDVQRIMVANIEEVLQRGEALSALDSKANNLSSLSKKY
RQDAKYLNMRSTYAKLAAVAVFFIMLIVYVRFWWL
NT seq 648 nt   +upstreamnt  +downstreamnt
atggtgttgctcacgatgatcgcccgggtggcggacgggctcccgttggccgcttcgatg
caggaggacgaacagtctggccgggaccttcagcagtaccaaagtcaggctaagcaactc
tttcgaaagttgaatgaacagtcccctaccagatgcaccttggaagctggcgccatgact
tttcactacattattgaacagggggtatgttatttggttttgtgtgaagctgccttccct
aagaagttggcttttgcgtacctagaagatttgcactcagagtttgatgaacagcatggg
aaaaaggttccgactgtgtctagaccctattcctttattgagtttgatacctacattcag
aaaaccaagaagctctacattgacagtcgtgctcggagaaacttaggttccatcaatact
gaattgcaagatgtgcagaggatcatggtggccaatattgaggaagtgttacaacgggga
gaagcactttcagcattggattcgaaggctaacaatttgtccagtctgtcaaagaaatac
cgccaggatgcgaagtacttgaacatgcgttccacttacgccaaacttgcagcagtagct
gtatttttcatcatgttaatagtgtatgtgcgattctggtggctgtga

DBGET integrated database retrieval system