KEGG   Sus scrofa (pig): 100157173Help
Entry
100157173         CDS       T01009                                 

Gene name
ACOT8
Definition
(RefSeq) acyl-coenzyme A thioesterase 8
  KO
K11992  acyl-CoA thioesterase 8 [EC:3.1.2.27]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00120  Primary bile acid biosynthesis
ssc01100  Metabolic pathways
ssc04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00120 Primary bile acid biosynthesis
    100157173 (ACOT8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    100157173 (ACOT8)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.27  choloyl-CoA hydrolase
     100157173 (ACOT8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 4HBT_3 Acyl_CoA_thio 4HBT
Motif
Other DBs
NCBI-GeneID: 100157173
NCBI-ProteinID: XP_001928924
Ensembl: ENSSSCG00000007426
UniProt: I3LA89 A0A4X1U116
Position
17
AA seq 317 aa AA seqDB search
MSSTEPPEDRQSGDDPPGDLRSVLVTSVLNLELLDQDLFRGRHYWVPSTQRLFGGQIVGQ
ALVAAAKSVSEDVHVHSLHCYFVRTGDPKVPVLYQVERTRTGASFSVRSVKAVQHGLPIF
ICQASFQQAQPSPLQHQFSMPTVPLPEELLSHEALIEQYLRDPNLQEKYRVGLNRIAAQE
VPIEIKVVNPPTLSQLRSMEPKQMFWVRARGYIGEGDMKMHCCVAAYISDYAFLGTALLP
HQRQHKVHFMVSLDHSMWFHAPFRADHWMLYECESPWAGGSRALVHGRLWRQDGVLAVSC
AQEGVIRVKPKVSKSKL
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccacggagcctcccgaggacagacagagcggcgacgatccacccggggacctc
cgcagtgtcctggtcaccagcgtgctcaatctcgagctcttggaccaggacctcttcaga
ggaaggcattactgggtaccctcaacccagcggctgtttgggggtcagattgtaggccag
gccctggtggctgcagccaagtctgtgagcgaagatgttcacgtgcactccctgcactgc
tactttgttcggacaggggacccgaaggtgccggtgctgtaccaggtggagcggacgcgg
acaggggcgagcttctctgtgcgctccgtgaaggccgtgcagcatggcctgcccatcttt
atctgccaggcctccttccagcaggcccagcccagcccccttcagcaccagttctccatg
cccaccgtgcccctgcccgaggagctgctgagccacgaggccctcattgaacagtattta
agggaccctaacctccaagagaagtaccgagtggggctgaaccgaattgctgcccaggag
gtgcccattgagatcaaggtggtcaacccacccaccctgagccagctgcggagcatggaa
ccaaaacagatgttctgggtgcgagcccgggggtacattggggagggcgacatgaagatg
cactgctgcgtggctgcctatatctcggactacgccttcctgggcacagcgctgctgccc
caccagaggcagcacaaggtgcacttcatggtctccttggaccactccatgtggttccac
gcccctttccgagcggaccactggatgctctatgagtgtgagagcccctgggctggtggt
tcccgggccctggttcatgggcggctgtggcgtcaggacggggtcctggctgtgtcctgt
gcccaggagggcgtgatccgagtgaagcccaaggtttcaaagagcaagctatag

DBGET integrated database retrieval system