KEGG   Sus scrofa (pig): 100157186
Entry
100157186         CDS       T01009                                 
Symbol
CHST11
Name
(RefSeq) carbohydrate sulfotransferase 11 isoform X3
  KO
K01017  chondroitin 4-sulfotransferase 11 [EC:2.8.2.5]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00532  Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00532 Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
    100157186 (CHST11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ssc01003]
    100157186 (CHST11)
Enzymes [BR:ssc01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.2  Sulfotransferases
    2.8.2.5  chondroitin 4-sulfotransferase
     100157186 (CHST11)
Glycosyltransferases [BR:ssc01003]
 Unclassified
  Sulfotransferases
   100157186 (CHST11)
SSDB
Motif
Pfam: Sulfotransfer_2
Other DBs
NCBI-GeneID: 100157186
NCBI-ProteinID: XP_013853454
Position
5:complement(79788558..80068903)
AA seq 312 aa
MRRNPFGVDICCRKGSRSPLQELYNPTQLDLSNTAVLHQMRRDQVTDTCRASSAMSRKRR
VLTPNDLKHLVVDEDHELIYCYVPKVACTNWKRLMMVLTGRGKYSDPMEIPANEAHVSAN
LKTLNQYSIPEINHRLKSYMKFLFVREPFERLVSAYRNKFTQKYNTSFHKRYGTKIIKRQ
RKNATQEALRKGDDVKFEEFVAYLIDPHTQREEPFNEHWQTVYSLCHPCHIHYDLVGKYE
TLEEDSNYVLQLAGVGSYLKFPTYAKSTRTTDEMTTEFFQNISSEHQTQLYEVYKLDFLM
FNYSVPSYLKLE
NT seq 939 nt   +upstreamnt  +downstreamnt
atgcggaggaatccctttggcgtggacatctgctgtcggaaggggtctcgaagccccctg
caggaactctacaacccgacccagctggacctctccaatacggccgtcctgcaccagatg
cgccgggaccaggtcacagacacgtgccgggccagcagcgccatgagccgcaagcggcgg
gtgctgacccccaacgacctcaagcacctggtggtggacgaagaccacgagctcatctac
tgctacgtgcccaaggtggcgtgcaccaactggaagcggctcatgatggtcctgaccggg
cgcgggaagtacagcgaccccatggagatcccggccaatgaggcgcacgtgtcggccaac
ctcaagaccctgaaccagtacagcatccccgaaatcaaccaccgcttgaaaagctacatg
aagttcctgttcgtgcgggagcccttcgaaaggctggtgtccgcctaccggaacaagttc
acgcagaagtacaacacctccttccacaagcgctacggcaccaagatcatcaagcggcag
cgcaagaacgccacgcaggaggccctgcgcaagggcgacgacgtcaagttcgaggagttc
gtagcctatctcatcgacccgcacacccagcgcgaggagcccttcaacgaacactggcag
accgtctactccctctgccacccgtgccacatccactacgacctcgtgggcaagtacgag
acgctggaggaggattccaattacgtcctgcagctggcgggcgtgggcagctacctgaag
ttccccacctacgccaagtccacgagaactactgatgagatgaccacggagttcttccag
aacatcagctccgagcaccaaacgcagctgtacgaagtctacaaactcgattttttaatg
ttcaattactcagtgccaagctacctgaaattggaatga

DBGET integrated database retrieval system