KEGG   Sus scrofa (pig): 100157211Help
Entry
100157211         CDS       T01009                                 

Gene name
LYZ
Definition
(RefSeq) lysozyme C-3 precursor
  KO
K13915  lysozyme C [EC:3.2.1.17]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Organismal Systems
  Digestive system
   04970 Salivary secretion
    100157211 (LYZ)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     100157211 (LYZ)
Exosome [BR:ssc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100157211 (LYZ)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lys SLT Destabilase Transglycosylas
Motif
Other DBs
NCBI-GeneID: 100157211
NCBI-ProteinID: NP_999557
Ensembl: ENSSSCG00000000492
Vega: OTTSUSG00000001652
UniProt: P12068
Position
5
AA seq 146 aa AA seqDB search
MKTLLVLALLLLSVSVQAKVYDRCEFARILKKSGMDGYRGVSLANWVCLAKWESDFNTKA
INHNVGSTDYGIFQINSRYWCNDGKTPKAVNACHISCKVLLDDDLSQDIECAKRVVRDPL
GVKAWVAWRAHCQNKDVSQYIRGCKL
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgaagactctcctcgttcttgcgcttctcctcctttctgtctctgtacaggccaaggtc
tatgatcggtgcgagttcgccagaattctgaaaaagtctggcatggacggctatagggga
gtcagcctggcgaactgggtgtgtttggccaagtgggaaagtgattttaacacaaaagct
ataaaccacaatgttggaagcactgattatggaatatttcaaattaatagccgctactgg
tgtaatgatggcaagacacccaaagcagttaatgcctgtcacatatcctgcaaagttttg
ctggacgatgacctcagtcaagatatagaatgtgcaaagagggttgtcagagatccacta
ggcgttaaagcatgggtggcatggagagctcattgtcagaacaaagatgtctcgcagtac
attcggggttgcaaactgtaa

DBGET integrated database retrieval system