KEGG   Sus scrofa (pig): 100157339
Entry
100157339         CDS       T01009                                 

Gene name
RAD51AP1
Definition
(RefSeq) RAD51-associated protein 1
  KO
K20778  RAD51-associated protein 1
Organism
ssc  Sus scrofa (pig)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ssc03400]
    100157339 (RAD51AP1)
DNA repair and recombination proteins [BR:ssc03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Other HR factors
     100157339 (RAD51AP1)
SSDB
Motif
Pfam: RAD51_interact
Other DBs
NCBI-GeneID: 100157339
NCBI-ProteinID: XP_001926415
Ensembl: ENSSSCG00000000722
Position
5
AA seq 337 aa
MVRPARHKKPVNYSQFENSDSDDDFVPATAPLSKKSRTTQKELKLEKPEPKLKNLQEKDI
PLQEKTPKKRMALDDKLYQRDLEVALALSVKELPTVTIDAEDCQDKSTDEHGSGNAETTV
KSPHISNCSVASDYLDLDKITEEGDSRGARGRRKAASQATVQQRKILLDGRDGNGDGDSD
SEPDFATGDDSEDDSDFCESEDDEALTVRKSKVKEIKKQKVKVKSPVEKKEKKPKSRRAA
VVTSVHSAPSAVKSESQPLPKKVSVSSEATEKPLQICSPSAESRRPKWVPPAASGSGSSS
RPLAGVAVKSPSQSLRLGLSRLARVKPLHPSAASSCV
NT seq 1014 nt   +upstreamnt  +downstreamnt
atggtgcggcctgcgaggcataagaagccagtcaattactcccagtttgagaactctgac
agtgatgatgattttgttcctgcaaccgcaccgttaagtaagaaatccagaacaacacaa
aaggagttaaaactagaaaaaccagaaccaaaactgaagaacctccaggaaaaagacatc
ccactacaagagaaaacccctaaaaaaaggatggctttagatgacaagctataccagaga
gacttagaagtcgcactggctttatcagtgaaggaacttccaactgtcaccattgatgcg
gaggactgtcaagataaaagcactgatgaacatggcagtggaaacgcagaaacgacagtt
aagtctcctcatatctccaactgcagcgtagccagtgattatttagatctggataagatc
accgaggaaggtgattctcgaggtgctcgagggaggagaaaggcagcatcccaagccacg
gtccagcagaggaagatcctcctggacggccgtgacggcaacggtgacggcgacagtgac
tccgaaccagactttgcaacaggtgacgattctgaggatgattctgatttttgtgagagt
gaggatgatgaagccctcactgtgagaaaaagcaaagttaaagaaatcaaaaagcaaaaa
gtgaaggtgaaatctccagttgaaaagaaagagaagaaacctaaatctagacgtgctgct
gtggtgacttcagtacactctgctccatctgccgtcaagtcagaatctcagcccttgcca
aaaaaggtttctgtttcttcagaggccactgagaagccattacaaatatgcagtccttcg
gctgaaagcaggagacctaagtgggtcccaccagcagcatcgggaagtggcagcagcagc
cgcccgctggcaggagtggctgtgaagtctccaagtcagagcctccgccttggcttgtcc
agattagcacgagttaaacctttgcatcccagcgccgctagtagttgtgtgtag

DBGET integrated database retrieval system