KEGG   Sus scrofa (pig): 100157774Help
Entry
100157774         CDS       T01009                                 

Gene name
SLC25A27
Definition
(RefSeq) mitochondrial uncoupling protein 4
  KO
K15112  solute carrier family 25 (mitochondrial uncoupling protein), member 27
Organism
ssc  Sus scrofa (pig)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ssc02000]
    100157774 (SLC25A27)
Transporters [BR:ssc02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   100157774 (SLC25A27)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mito_carr Serine_protease Couple_hipA
Motif
Other DBs
NCBI-GeneID: 100157774
NCBI-ProteinID: NP_001182044
Ensembl: ENSSSCG00000001720 ENSSSCG00000026035
UniProt: D9IZY8
Position
7
AA seq 328 aa AA seqDB search
MSAPEDEERLLPLAQRWPRASKFLLSGCAATVAELATFPLDLTKTRLQIQGEAALARLGH
GAREAALYRGMVRTALGIVQEEGFLKLWQGVTPAIYRHIVYSGGRMVTYEHLREVVFGKG
EDKHYPLWKSVIGGMMAGVVGQFLANPTDLVKVQMQMEGKRKLEGKPLRFRGVHHAFAKI
LPEGGVRGLWAGWVPNIQRAALVNMGDLTTYDTVKHYLVLNTPLEDNIMTHGLSSLCSGL
VASILGTPADVIKSRIMNQPRDKQGRGLLYKSSTDCLVQAVQGEGFMSLYKGFLPSWLRM
VNNLIGSHKATQRNPAPCSLKKNQILPT
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgtcggctccagaggatgaggagaggctcctgccgctcgcccagagatggccccgcgca
agcaagtttctcctgtccggctgcgcagccaccgtggccgagctagcaacctttcccctc
gatctcacaaaaactcgactccaaatacaaggagaagctgccctcgctcggctgggacat
ggtgcaagagaggctgctctctatcggggcatggtgcgtacggccctagggattgtccaa
gaggagggctttctgaagctctggcaaggagtgacacctgccatttacagacacatagtg
tactctggaggtcgaatggtcacttatgaacatctccgcgaagttgtgtttggcaagggt
gaagataagcattatcccctttggaaatcagtgattggagggatgatggctggtgttgtt
ggccaatttctggccaacccgactgacctagtgaaggttcagatgcaaatggaagggaaa
aggaaactcgaaggaaagccgttgcgatttcgtggtgtgcatcatgcatttgccaaaatc
ttacctgaaggaggagtacgtgggctttgggcaggctgggtacccaatatccaaagagca
gcgctggtgaatatgggagatttaaccacttatgacacagtgaaacattacttggtattg
aatacaccccttgaggacaatatcatgactcatggcttgtcaagtttatgttctggactg
gtagcttctattctgggaacacctgctgatgtcatcaaaagccgaataatgaatcaaccg
cgagataaacaaggaaggggccttctgtataaatcatcgactgactgcttggttcaggct
gtccaaggagaaggattcatgagtctctataaaggctttctaccatcttggctgcgaatg
gtaaacaatctgattggatcacacaaggccacccaacgcaacccagcaccgtgttctcta
aagaagaatcaaatcctgcccacttag

DBGET integrated database retrieval system