KEGG   Sus scrofa (pig): 100157795
Entry
100157795         CDS       T01009                                 

Gene name
GJA5
Definition
(RefSeq) gap junction alpha-5 protein
  KO
K07614  gap junction alpha-5 protein
Organism
ssc  Sus scrofa (pig)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    100157795 (GJA5)
SSDB
Motif
Pfam: Connexin Connexin40_C
Other DBs
NCBI-GeneID: 100157795
NCBI-ProteinID: XP_001928335
Ensembl: ENSSSCG00000006696
UniProt: F1SDC3 A0A4X1SLG1
Position
4
AA seq 358 aa
MGDWSFLGEFLEEVHKHSTVIGKVWLTVLFIFRMLVLGTAAESSWGDEQADFQCDTMQPG
CENVCYDQAFPISHIRYWVLQIIFVSTPSLVYMGHAMHTVRVQEKRKLREAERAKEVRGA
GSYEYPVAEKTELSCWEEVNGRIVLQGTLLNTYVFSILIRTTMEVAFIVGQYLLYGIFLD
TLHVCRRSPCPHPVNCYVSRPTEKNVFIVFMLAVAGLSLFLSLAELYHLGWKKIRQRFVK
SQQGLAECQLPSPSAGMVQSCTPPPDFSQCLENGPGEKFFSPFSNKVASQQNTDNLATEQ
VRGQEQIPGEGFIHIRYAQKSEVPNESAPGHRLPHGYQSDKRRLSKASSKARSDDLSV
NT seq 1077 nt   +upstreamnt  +downstreamnt
atgggagactggagcttcctgggagaattcctggaggaggtgcacaagcactccacagtg
atcggcaaggtctggctcaccgtcctcttcatattccgcatgctggtgctgggcacggct
gccgagtcatcctggggcgatgagcaggctgatttccagtgtgatacgatgcaacctggt
tgcgagaacgtgtgctacgaccaagccttccccatctcccacattcgctattgggtgctg
cagatcatctttgtctccacaccctctctggtgtacatgggccatgccatgcacacggtg
cgtgtgcaggagaagcggaagctccgggaagccgagagggccaaagaggttcggggcgct
ggctcttacgagtacccagtggctgagaagacagagctgtcctgctgggaagaagtgaac
ggaaggattgtcctgcagggcacgctgctcaacacctatgtcttcagcatcctgatccgc
accaccatggaggtggccttcatcgtgggccagtacctcctctacgggatcttcctggac
accctgcacgtctgccgcaggagcccctgcccgcatcctgtcaactgttacgtctcccgg
cccacggagaagaatgtcttcattgtctttatgctggctgtggccggactgtcccttttc
ctcagccttgctgaactctaccacctgggctggaaaaagatcagacagcgatttgtcaag
tcgcagcagggcctggctgagtgccagcttcccagtccctctgcaggtatggtccagagc
tgcacaccaccccccgacttcagtcagtgcctggagaatggccctggggagaaattcttc
agtccattcagtaacaaggtggcctcccagcagaacacagataacctggccactgagcaa
gtgcgaggccaggagcagattccaggagagggtttcattcacatccgttatgcccagaag
tccgaggtacccaatgaaagtgccccaggtcaccgcctcccccatggctaccagagtgac
aagcgccgtctcagcaaggccagcagcaaggccaggtcagacgacctatcggtgtga

DBGET integrated database retrieval system