KEGG   Sus scrofa (pig): 100158107
Entry
100158107         CDS       T01009                                 

Gene name
PICK1
Definition
(RefSeq) PRKCA-binding protein
  KO
K24062  PRKCA-binding protein
Organism
ssc  Sus scrofa (pig)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:ssc04990]
    100158107 (PICK1)
Domain-containing proteins not elsewhere classified [BR:ssc04990]
 PDZ domain-containing proteins
  Other PDZ domain-containing proteins
   100158107 (PICK1)
SSDB
Motif
Pfam: Arfaptin PDZ PDZ_6 BAR PDZ_2 BAR_3 GRASP55_65
Other DBs
NCBI-GeneID: 100158107
NCBI-ProteinID: XP_003355387
Ensembl: ENSSSCG00000000114
UniProt: F1SKP0
Position
5
AA seq 417 aa
MFADLDYDIEEDKLGIPTVPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAAL
DGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQADPKQGMSLDIVLKK
VKHRLVENMSSGTADALGLSRAILCNDGLVKRLEELERTAELYKGMTEHTKNLLRAFYEL
SQTHRAFGDVFSVIGVREPQPAASEAFVKFADAHRSIEKFGIRLLKTIKPMLTDLNTYLN
KAIPDTRLTIKKYLDVKFEYLSYCLKVKEMDDEEYSCIALGEPLYRVSTGNYEYRLILRC
RQEARARFSQMRKDVLEKMELLDQKHVQDIVFQLQRFVSTMSKYYNDCYAVLRDADVFPI
EVDLAHTTLAYGPGQDEFTDGEDEEEEDEEDTAAGEPSRDAQGAAGPLDKGGSWCDS
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgtttgcagacttggattatgacatcgaagaggataaactcggaatccctactgtgcct
gggaaggtgaccttgcagaaggatgctcagaacctgattgggatcagcattggaggagga
gcccagtactgtccctgcctgtatatagtccaggtgtttgacaacaccccggccgcgctg
gacggcaccgtggcagccggcgatgagatcactggggtcaatggcaggtccatcaaagga
aaaacgaaggtggaggtggccaagatgattcaggaggtgaagggggaggtgaccatccac
tacaacaagctgcaggcggaccccaagcagggcatgtccctggacatcgtgttgaagaag
gtgaagcatcggctggtggagaacatgagttcggggaccgccgatgccctgggcctgagc
cgggccatcctgtgcaatgatgggcttgtcaagaggctcgaggagctggaacggacggca
gagctgtataaagggatgacggaacacaccaagaacctcctacgggccttctatgagctg
tcacagacgcaccgggcctttggggacgtattctccgtgatcggggtgcgggagccccag
ccagctgcgagtgaggcttttgtgaagttcgccgacgcccaccgcagcattgagaagttt
ggcatccggctgctgaaaaccatcaagccgatgctgacggacctgaacacgtacctcaac
aaagccatcccggacacgcgcctcaccatcaagaagtacctggacgtgaagtttgaatac
ctgtcgtactgcctgaaggtgaaggagatggatgacgaggaatacagctgcatcgcccta
ggggagcccctgtaccgcgtgagcacaggcaactacgagtaccggctgatcctgcgctgc
cgccaggaggcccgcgcccgcttctcccagatgcgcaaggacgtgctggagaagatggag
ctgctggaccagaagcacgtccaggacatcgtgttccagctgcaacgcttcgtgtccacc
atgtccaagtactacaacgactgctacgcggtgctgcgggacgccgacgtcttccccatc
gaggtggacctggcccacaccacgctggcctacggccccggccaggacgagttcaccgac
ggggaggacgaggaggaggaggacgaggaggacacggccgccggggagccgtccagggac
gcgcaaggggcggcggggcctctggacaagggcggaagctggtgtgactcctga

DBGET integrated database retrieval system