KEGG   Sus scrofa (pig): 100158117Help
Entry
100158117         CDS       T01009                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: histone H4
  KO
K11254  histone H4
Organism
ssc  Sus scrofa (pig)
Pathway
ssc05034  Alcoholism
ssc05203  Viral carcinogenesis
ssc05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09160 Human Diseases
  09161 Cancers: Overview
   05203 Viral carcinogenesis
    100158117
  09163 Immune diseases
   05322 Systemic lupus erythematosus
    100158117
  09165 Substance dependence
   05034 Alcoholism
    100158117
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ssc03036]
    100158117
Chromosome and associated proteins [BR:ssc03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    100158117
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CENP-T_C TAF CENP-S Histone CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137
Motif
Other DBs
NCBI-GeneID: 100158117
NCBI-ProteinID: XP_005665718
Ensembl: ENSSSCG00000022049
UniProt: P62802
Position
7
AA seq 103 aa AA seqDB search
MSGRGKGGKGXGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atgtctggtcgcggcaaaggcgggaagggcntgggcaaagggggcgccaagcgccaccgc
aaggtgctgcgggacaacatccagggcatcaccaagcccgccatccggcgcctggcccgg
cgcggcggcgtcaagcgcatctccggcctcatctacgaggagacccgcggggtgctgaag
gtgttcctggagaacgtgatccgggacgccgtcacctacaccgagcacgccaagcgcaag
accgtcaccgccatggacgtggtctacgcgctcaagcgccaagggcgcaccctctacggc
ttcggcggctaa

DBGET integrated database retrieval system