KEGG   Sus scrofa (pig): 100233174Help
Entry
100233174         CDS       T01009                                 

Gene name
CPNE1
Definition
(RefSeq) copine-1
Organism
ssc  Sus scrofa (pig)
SSDB OrthologParalogGFIT
Motif
Pfam: Copine C2 vWA-TerF-like VWA
Motif
Other DBs
NCBI-GeneID: 100233174
NCBI-ProteinID: NP_001137175
Ensembl: ENSSSCG00000007306
UniProt: B8XSK0
Position
17
AA seq 537 aa AA seqDB search
MAHCVTLVQLSISCDHLTDKDIGSKSDPLCVLLQDVGGGTWAELGRTERVRNCSSPEFSK
TLQLEYHFETVQKLRFGIYDIDNKTPELGDDDFLGGAECSLGQIVSSQILTLPLMLKPGK
PAGRGTITVSAQELKDSRVVTMEVEARNLDKKDFLGKSDPFLEFFRQGDGKWHLAYRSEV
IKNNLNPTWKRFSVPFQHFCGGDPSTPIQVRCSDYDSDGSHDLIGPFHTTLAQLQAVPAE
FECIHPEKQQKKKSYKNSGIVRVKICQVETEYSFLDYVMGGCQINFTVGVDFTGSNGDPS
SPDSLHYLSPTGVNEYLTALWSVGSVVQDYDSDKLFPAFGFGAQVPPDWQVSHEFALNFN
PSNPYCAGIQGIVDAYRQALPQVRLYGPTNFAPIINHVARFAAQAAHQKSASQYFVLLLL
TDGAVTDVEATREAVVRASYLPMSVIIVGVGGADFEAMEQLDADGGPLHTRSGEAAARDI
VQFVPYRRFQNAPREALAQTVLAEVPTQLVSYFKAQGWAPFKPLPPPTKGPAQAPQA
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atggcccactgcgtgaccttggttcagctgtccatttcatgtgaccacctcactgacaag
gacatcggctccaagtctgacccactctgtgtccttttacaggatgtaggagggggcacc
tgggctgagcttggccgtacagagcgagtacggaactgctcgagccctgagttctccaag
actctgcagcttgagtaccactttgaaacggttcaaaaactccgatttggtatctatgac
atagacaataagacgcctgagctgggggatgatgacttcctaggaggggctgagtgttcc
ctaggacagattgtatccagccagatactaactctacccttgatgttgaagcctggaaaa
cctgctgggcgagggaccatcacggtctcagctcaggagttgaaggatagtcgagtagtg
accatggaggtggaggccagaaacctagataagaaggacttcctggggaaatcagatcca
ttcttggagttcttccgccagggtgatgggaaatggcacctggcatacagatcagaggtc
atcaagaacaacctgaaccctacttggaagcgcttctctgttccttttcagcatttctgt
gggggagaccccagtacacccatccaggtgcgatgttcggattatgacagcgatggttca
catgatctcattggtcccttccacactaccttggcccaactgcaggcagtcccggctgag
tttgaatgcatccaccctgagaaacagcagaaaaagaaaagctacaagaactctggaata
gtccgtgtcaagatttgtcaggtagaaacagagtattcattcctggactatgtgatggga
ggctgtcaaatcaacttcactgtgggtgtggacttcacaggctccaatggagatccttcc
tcacctgattctctgcactacctgagcccaacaggggtcaatgagtacctgacagcactg
tggagtgtgggcagcgtggttcaggactatgactcggacaagctgttcccagcatttgga
tttggggctcaggtaccccctgactggcaggtctcccatgaatttgccttgaacttcaac
cccagtaacccctactgtgcaggcatccagggcattgtggatgcctaccgccaggcccta
ccccaagttcgcctctatggtcccaccaactttgcacccatcatcaaccatgtggccagg
tttgcagcccaggctgctcatcagaagagtgcctcgcaatacttcgtgctgttgctgcta
actgatggtgctgtgacagatgtggaggccacacgtgaggctgtggttcgagcctcctac
ctgcccatgtcagtgatcatcgtgggtgtgggtggtgctgacttcgaggccatggagcaa
ctggacgctgatggcggacccctgcatacacgctccggggaggcagctgctcgtgacata
gtgcaatttgtgccctaccgccgctttcagaatgcccctcgagaggcattggcgcagact
gtacttgcagaagtacccacgcaactggtttcctacttcaaggcccaaggttgggctcca
ttcaagccactcccacccccaaccaagggccctgcacaggcccctcaggcctag

DBGET integrated database retrieval system