KEGG   Sus scrofa (pig): 100233193Help
Entry
100233193         CDS       T01009                                 

Gene name
MGLL
Definition
(RefSeq) monoglyceride lipase
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00561  Glycerolipid metabolism
ssc01100  Metabolic pathways
ssc04714  Thermogenesis
ssc04723  Retrograde endocannabinoid signaling
ssc04923  Regulation of lipolysis in adipocytes
Module
ssc_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    100233193 (MGLL)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocyte
    100233193 (MGLL)
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    100233193 (MGLL)
  09159 Environmental adaptation
   04714 Thermogenesis
    100233193 (MGLL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ssc01002]
    100233193 (MGLL)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     100233193 (MGLL)
Peptidases [BR:ssc01002]
 Serine Peptidases
  Family S33
   100233193 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 Esterase Lipase_3 PGAP1 Thioesterase Abhydrolase_3 Abhydrolase_5 Peptidase_S9 LIDHydrolase Chlorophyllase2 DUF1057 Abhydrolase_2 BAAT_C DUF1350
Motif
Other DBs
NCBI-GeneID: 100233193
NCBI-ProteinID: NP_001137190
Ensembl: ENSSSCG00000024134
UniProt: B8XSJ9
Position
13
AA seq 303 aa AA seqDB search
MPEEGSPRRTPQSVPYQDIPHLVNADGQYLFCRYWKPSATPRALVFVSHGAGEHCGRYEE
LARMLVGLGLLVFAHDHVGHGQSEGERMVVSDFQVFVRDVLHHVDVMQKDHPQLPVFLLG
HSMGGAIAILTAAERPGHFSGMVLISPLVLASPESATTFKILAAKVLNLVLPNMSLGRID
ASVLSRNKTEVDLYNADPLICRAGLKVCFGIQLLNAVSRVERALPKLTLPFLLLQGSADR
LCDSRGAYLLMESAKSQDKTLKIYEGAYHILHKELPEVTDSVFREINTWVSQRTAAMGTG
SPP
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgccagaggaaggttccccccggcggaccccacagagtgtcccataccaggacatccct
cacctggtcaatgctgacggacagtaccttttctgcaggtattggaaaccctcagctaca
cccagggccctggtctttgtgtcgcacggagccggggagcactgtggccgctacgaggag
ctggctcggatgctggtagggctggggctgctggtgttcgcccacgaccatgttggccac
gggcagagcgagggagagaggatggtggtatctgacttccaggtgttcgtcagggacgtg
ttgcaccacgtggatgtcatgcagaaggaccacccacagctcccagtcttccttctgggc
cactccatgggaggtgccattgccatcctcacggctgcagagaggccaggccacttctcc
ggcatggttctgatctctccactggttcttgccagtcctgagtctgcaacaactttcaag
atccttgctgcgaaagtgctcaaccttgtcctgccaaacatgtccctgggccggattgac
gccagcgtgctctccaggaataaaacagaggtggacctctacaatgcagatccacttatc
tgccgggcaggactgaaagtgtgcttcggcatccagctgctcaacgccgtttcacgggtg
gagcgggccctgcccaagctgaccttgcccttcctgctgctccagggctctgctgaccgc
ctgtgcgacagcagaggggcctacctgctcatggagtccgccaagagccaggacaagaca
ctgaagatttatgagggtgcctaccacattctccacaaagagcttcctgaggtgaccgat
tccgtcttccgtgagataaatacatgggtctcccaaaggacagcggctatggggacaggg
tccccaccctga

DBGET integrated database retrieval system