KEGG   Sus scrofa (pig): 100294678Help
Entry
100294678         CDS       T01009                                 

Gene name
PDHA1
Definition
(RefSeq) pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial
  KO
K00161  pyruvate dehydrogenase E1 component alpha subunit [EC:1.2.4.1]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00010  Glycolysis / Gluconeogenesis
ssc00020  Citrate cycle (TCA cycle)
ssc00620  Pyruvate metabolism
ssc01100  Metabolic pathways
ssc01200  Carbon metabolism
ssc04066  HIF-1 signaling pathway
ssc04922  Glucagon signaling pathway
ssc05230  Central carbon metabolism in cancer
Module
ssc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100294678 (PDHA1)
   00020 Citrate cycle (TCA cycle)
    100294678 (PDHA1)
   00620 Pyruvate metabolism
    100294678 (PDHA1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    100294678 (PDHA1)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    100294678 (PDHA1)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    100294678 (PDHA1)
Enzymes [BR:ssc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     100294678 (PDHA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E1_dh DXP_synthase_N TPP_enzyme_C
Motif
Other DBs
NCBI-GeneID: 100294678
NCBI-ProteinID: XP_003360292
Ensembl: ENSSSCG00000023643
Vega: OTTSUSG00000004407
UniProt: I3LCI2 A0A5K1VBH1 A0A480VQH5 A0A4X1V4S1
Position
X
AA seq 390 aa AA seqDB search
MRKMLAAVSRVLSGVAQKPASRVLVASRNFANDATFEIKKCDLHRLEEGPPVTTVLTRED
GLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQEACCVGLEAGINPTDHLITAYRA
HGFTFTRGLSVREILAELTGRRGGCGKGKGGSMHMYAKNFYGGNGIVGAQVPLGAGIALA
CKYNGKDEVCLTLYGDGAANQGQIFEAYNMAALWKLPCVFICENNRYGMGTSVERAAAST
DYYKRGDFIPGLRVDGMDILCVREATRFAAAYCRSGKGPILMELQTYRYHGHSMSDPGVS
YRTREEIQEVRSKSDPIMLLKDRMVNSNLASVEELKEIDVEVRKEIEDAAQFATADPEPP
LEELGYHIYCNDPPFEVRGANQWIKFKSIS
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaggaagatgctcgccgccgtctcccgcgtgttgtcgggcgtcgcccagaagccggca
agcagagtgctggtggcgtcccgtaactttgcaaatgatgctacatttgaaattaagaaa
tgtgatcttcaccggctggaagagggcccacctgtcaccacggtgctcaccagggaggat
gggctcaagtactacaggatgatgcagactgttcgccgaatggagttaaaagcagatcag
ctctataaacagaaaattattcgtggtttctgtcacttgtgtgatggtcaggaagcttgt
tgcgtgggcctggaggctggcataaaccctacggaccatctgatcacagcctaccgagct
catggctttacctttactcgtgggctttctgtccgggaaattcttgcggaacttacagga
cgaagaggaggttgtggtaaaggaaaaggaggatcgatgcatatgtatgccaagaacttc
tacgggggcaatggcattgtgggagctcaggtgcccctgggagctgggattgctctggcc
tgtaagtataatggaaaagatgaggtctgtttgactttgtatggagatggtgctgctaat
cagggtcagatatttgaagcttacaacatggcagctttgtggaaattgccttgtgttttc
atctgtgagaataatcgctatgggatgggaacgtctgtggagagagccgcagccagcact
gactactataagagaggcgacttcattcctgggctgagggtagatggaatggatatcctg
tgtgtccgggaggccacaaggtttgcagctgcctactgtagatctggaaaggggcccata
ctgatggagctgcagacttaccgttaccatggacacagtatgagtgatcccggagtcagt
taccgtacacgagaagaaattcaggaagtaagaagtaagagtgacccgatcatgcttctc
aaggatagaatggtgaacagcaatcttgccagtgttgaagaattaaaggaaatcgatgtt
gaagtgaggaaagaaattgaggatgctgcacagtttgctactgctgatcctgaaccacct
ttggaagaactcggctatcacatctactgcaacgacccgccttttgaagtccggggtgca
aaccagtggatcaagtttaagtccatcagttaa

DBGET integrated database retrieval system