KEGG   Sus scrofa (pig): 100301570Help
Entry
100301570         CDS       T01009                                 

Gene name
ARF3
Definition
(RefSeq) ADP-ribosylation factor 3
  KO
K07938  ADP-ribosylation factor 3
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100301570 (ARF3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ssc04131]
    100301570 (ARF3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ssc04147]
    100301570 (ARF3)
   04031 GTP-binding proteins [BR:ssc04031]
    100301570 (ARF3)
Membrane trafficking [BR:ssc04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPases
    100301570 (ARF3)
Exosome [BR:ssc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100301570 (ARF3)
  Exosomal proteins of colorectal cancer cells
   100301570 (ARF3)
GTP-binding proteins [BR:ssc04031]
 Small (monomeric) G-proteins
  Arf/Sar Family
   Arf [OT]
    100301570 (ARF3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arf SRPRB Roc Ras G-alpha Gtr1_RagA MMR_HSR1 6PF2K
Motif
Other DBs
NCBI-GeneID: 100301570
NCBI-ProteinID: NP_001153898
UniProt: C4MRC5
Position
5
AA seq 181 aa AA seqDB search
MGNIFGNLLKSLIGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKS
ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAV
LLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLANQLKNK
K
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgggtaatatctttggaaacctcctcaagagcctgattgggaagaaggagatgcgcatc
ctgatggtgggtctggatgccgcggggaagaccaccatcctgtacaagctgaaactgggc
gagatcgtcaccaccatccccaccattgggttcaacgtggagacggtggagtacaagagc
attagcttcacagtttgggatgtgggtggccaggacaagattcggcctctctggagacat
tacttccagaacactcaagggttgatatttgtggtcgacagcaatgatcgggagcgagta
aatgaggcccgggaggagctgatgaggatgctggcagaggatgagctgcgggatgctgtg
ctccttgtctttgcgaacaaacaggatttgcctaatgctatgaacgctgctgagatcaca
gacaagttgggcctgcattccctgcgtcaccgcaactggtacattcaggccacctgtgcc
accagtggggacgggctgtacgaaggcctggactggctggccaatcagctcaaaaacaag
aagtga

DBGET integrated database retrieval system