KEGG   Sus scrofa (pig): 100337659
Entry
100337659         CDS       T01009                                 

Gene name
EPHB3
Definition
(RefSeq) ephrin type-B receptor 3 isoform X1
  KO
K05112  Eph receptor B3 [EC:2.7.10.1]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100337659 (EPHB3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ssc01001]
    100337659 (EPHB3)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100337659 (EPHB3)
Protein kinases [BR:ssc01001]
 Receptor tyrosine kinases (RTK)
  EPH family [OT]
   100337659 (EPHB3)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ephrin_lbd Pkinase fn3 EphA2_TM SAM_1 SAM_2 Ephrin_rec_like Pur_ac_phosph_N Interfer-bind Cadherin_C_2
Other DBs
NCBI-GeneID: 100337659
NCBI-ProteinID: XP_003358781
Ensembl: ENSSSCG00000011785 ENSSSCG00000026516 ENSSSCG00000030202
UniProt: F1SG86
Position
13
AA seq 999 aa
MARARPPPPQPPGLLPLLSPLLLLLPLLLPTGCRALEETLMDTKWVTSELAWTSHPESGW
EEVSGYDEAMNPIRTYQVCNVRESSQNNWLRTGFIWRRDVQRVYVELKFTVRDCNSIPNI
PGSCKETFNLFYYEADSDVASASSPFWMENPYVKVDTIAPDESFSRLDAGRVNTKVRSFG
PLSKAGFYLAFQDQGACMSLISVRAFYKKCASTTAGFALFPETLTGAEPTSLVIAPGTCI
ANAVEVSVPLKLYCNGDGEWMVPVGACTCATGHEPAAKESQCRPCPPGSYKAKQGEGPCL
PCPPNSRTTAPAASICTCHNNFYRADSDSADAACTTVPSPPRGVISNVNETTLILEWSEP
RDLGGRDDLLYNVICKKCHGSPGAGGAMTCSRCDDNVEFVPRQLGLTERRVHISHLLAHT
RYTFEVQAVNGVSGKSPLPPRYAAVNITTNQAAPSEVPTLHLHSSSGSSLTLSWTPPERP
NGVILDYEMKYFEKSEGIASTVTSQKNSVQLDGLRPDARYVVQVRARTVAGYGQYSRPAE
FETTSERGSGAQQLQEQLPLIVGSATAGLVFVVAVVVIAVVCLRKQRHGPDSEYTEKLQQ
YIAPGMKVYIDPFTYEDPNEAVREFAKEIDVSCVKIEEVIGAGEFGEVCRGRLKQPGRRE
VFVAIKTLKVGYTERQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMILTEFMENCAL
DSFLRLNDGQFTVIQLVGMLRGIAAGMKYLSEMNYVHRDLAARNILVNSNLVCKVSDFGL
SRFLEDDPADPTYTSSLGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPY
WDMSNQDVINAVEQDYRLPPPMDCPTALHQLMLDCWVRDRNLRPKFSQIVNTLDKLIRNA
ASLKVIASAQSGMSQPLLDRTVPDYTTFTTVGDWLDAIKMGRYKESFVSAGFASFDLVAQ
MTAEDLLRIGVTLAGHQKKILSSIQDMRLQMNQTLPVQV
NT seq 3000 nt   +upstreamnt  +downstreamnt
atggcccgagcccgcccgccgccgccgcagccgccgggactcttgccgctgctctctccg
ctgctgctgctgctgccgctgctgctgcccaccggctgtcgggcgctggaagagaccctc
atggatacaaagtgggtgacatctgagttggcgtggacatctcatccagagagtgggtgg
gaagaggtgagcggctacgacgaggccatgaaccccatccgcacctaccaggtgtgtaac
gtgcgtgagtcaagccagaacaactggcttcgcacagggttcatctggcggcgggatgtg
cagcgggtctacgtggagctcaagttcactgtgcgtgactgcaacagcatccccaacatc
cctggctcctgcaaggagaccttcaacctcttttactacgaggctgacagtgacgtggcc
tcggcctcctcccccttctggatggagaacccctatgtgaaggtggacaccatcgcgccc
gatgagagcttctcgcggctcgatgccggccgtgtcaacaccaaggtgcgcagcttcggg
ccgctctccaaggccggcttctacttggccttccaggaccagggcgcctgcatgtccctc
atctccgtgcgtgccttctacaagaagtgcgcgtccaccactgccggcttcgcgctcttc
cccgagacactcactggggctgagcccacctccctggtcattgcccccggcacgtgcatt
gccaacgctgtggaggtgtcggtgccactcaagctttactgcaacggtgatggggagtgg
atggtgcctgtgggcgcctgcacctgtgccaccggccacgaaccagctgccaaggagtcc
cagtgccgcccctgtcctcctgggagctacaaggcaaagcagggagagggcccctgcctc
ccctgccctcccaacagccgcaccaccgcgccagccgccagcatctgcacctgccacaat
aacttctaccgcgcagactctgactctgcagatgctgcctgtaccacggtgccgtctccc
ccccggggtgtgatctccaatgtgaatgagaccacgctgatcctcgagtggagcgagccc
cgggacctgggtggccgggacgacctcctatacaacgtcatctgcaagaagtgccatggg
agccccggggccgggggtgccatgacctgctcgcgctgcgatgacaatgtggagtttgtg
cctcggcagctgggcctgacagagcgccgggtccacatcagccacctgctggcccacacg
cgctacacctttgaggtgcaagcggtcaacggtgtctcgggcaagagccctctgcctcct
cgatacgcggctgtgaatatcaccaccaaccaggctgctccatctgaagtgcctacgcta
cacctgcacagcagctccgggagcagcctgaccctgtcctggacgcccccagagcggccc
aacggagtcatcctggactacgagatgaagtactttgagaagagcgagggcatcgcctcc
acagtgaccagccagaagaactccgtgcagctagacgggctgcggcctgacgcccgctat
gtggtccaggtccgtgcccgcaccgtagctggctatgggcagtacagccgcccggctgag
tttgagaccacaagcgagagaggctccggtgcccagcagctgcaggagcagctcccgctc
attgtgggctctgccacggccgggcttgtcttcgtggtggctgtcgtggtcattgctgtt
gtctgcctcaggaagcagcggcatggccccgattcggagtacacggagaagctgcagcaa
tacattgctcctggaatgaaggtttatatcgacccttttacctacgaagaccctaatgag
gccgtacgggaatttgccaaggagatcgatgtgtcctgtgtcaagatcgaggaggtgatt
ggagctggggagtttggggaagtgtgccggggtaggctgaaacagcctggccgccgggag
gtatttgtggccatcaagacgctgaaggtgggctacacagagaggcagcggcgggacttc
ctcagcgaggcctccatcatgggtcagtttgaccaccccaacatcatccgcctggagggt
gtggtcaccaaaagccggccagtcatgatcctcactgagttcatggagaactgcgccctg
gactccttcctccggctcaacgacggacagttcacggtcatccagctggtgggcatgttg
cggggcattgctgctggcatgaagtacctgtcggagatgaactatgtgcaccgcgacctg
gctgcccgcaacatcctcgtcaacagcaacctggtctgcaaagtctcagacttcggcctc
tcccgcttcctggaggatgatcccgctgatcctacatataccagctccctgggcgggaag
atccccatccgctggaccgccccagaggccatagcctatcggaagttcacttctgctagt
gatgtctggagctatggaatcgtcatgtgggaggtcatgagctacggcgagcgaccgtac
tgggacatgagcaaccaggatgtcatcaatgccgtggagcaggattaccggctgccccca
cccatggactgccccactgcgctgcaccagctcatgctggactgctgggtgcgggaccgg
aacctcaggcccaaattctcccagattgtcaacaccctggataagctcatccgcaacgcc
gccagccttaaagtcatcgccagtgcccagtctggcatgtcacaacccctcctggaccgc
acggtcccggactacaccaccttcacgacagttggtgactggctggacgccatcaagatg
gggcggtacaaggagagcttcgtcagcgcggggtttgcatcctttgacctggtggcccag
atgaccgcagaagacctgctccggatcggggtcaccttggctggccaccagaagaagatc
ctcagcagtatccaggacatgcgcctgcagatgaaccagacactgcctgtgcaggtctga

DBGET integrated database retrieval system