KEGG   Sus scrofa (pig): 100511152Help
Entry
100511152         CDS       T01009                                 

Gene name
TPP2
Definition
(RefSeq) tripeptidyl-peptidase 2 isoform X1
  KO
K01280  tripeptidyl-peptidase II [EC:3.4.14.10]
Organism
ssc  Sus scrofa (pig)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ssc01002]
    100511152 (TPP2)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ssc03110]
    100511152 (TPP2)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.10  tripeptidyl-peptidase II
     100511152 (TPP2)
Peptidases and inhibitors [BR:ssc01002]
 Serine peptidases
  Family S8: subtilisin family
   100511152 (TPP2)
Chaperones and folding catalysts [BR:ssc03110]
 Intramolecular chaperones
  Subtilisin family
   100511152 (TPP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 TPPII TPPII_N
Motif
Other DBs
NCBI-GeneID: 100511152
NCBI-ProteinID: XP_020921541
Position
11
AA seq 1288 aa AA seqDB search
MATAATEEPFPFHGLLPKKETGAASFLCRYPEYDGRGVLIAVLDTGVDPGAPGMQVTTDG
KPKIIDIIDTTGSGDVNTATVAEPKDGELIGLSGRVLKIPASWTNPSGRYHIGIKNGYDF
YPKALKERIQKERKEKIWDPVHRVALAEACRKQEEFDVANSCPSQVGASCFDILSHYRLL
QDIECSSLCYTANKLIKEELQSQVELLNSFEKKYSDPGPVYDCLVWHDGETWRACIDSNE
DGDLSKSTVLRNYKEAQEYGSFGTAEMLNYSVNIYDEGNLLSIVTSGGAHGTHVASIAAG
HFPEEPERNGVAPGAQILSIKIGDTRLSTMETGTGLIRAMIEVINHKCDLVNYSYGEATH
WPNSGRICEVISEAVWKHNIIYVSSAGNNGPCLSTVGCPGGTTSSVIGVGAYVSPDMMVA
EYSLREKLPANQYTWSSRGPSADGALGVSISAPGGAIASVPNWTLRGTQLMNGTSMSSPN
ACGGIALILSGLKANNADYTVHSVRRALENTAVKADNIEVFAQGHGIIQVDKAYDYLVQN
TSFANKLGFTVTVGNNRGIYLRDPIQVAAPSDHGVGIEPVFPENTENSEKISLQLHLALT
SNSSWVQCPSHLELMNQCRHINIRVDPRGLREGLHYTEVCGYDTASPNAGPLFRVPITAV
IAAKVNESSHYDLAFTDVHFKPGQIRRHFIEVPEGATWAEVTVCSCSSEVSAKFVLHAVQ
LVKQRAYRSHEFYKFCSLPEKGTLTEAFPVLGGKAIEFCIARWWASLSDVNIDYTISFHG
IVCTAPQLNIHASEGINRFDVQSSLKYEDLAPCITLKSWVQTLRPLSAKTKPLGSRDVLP
NNRQLYEMILTYNFHQPKSGEVTPSCPLLCELLYESEFDSQLWIIFDQNKRQMGSGDAYP
HQYSLKLEKGDYTIRLQIRHEQISDLERLKDLPFIVSHRLSNTLSLDIHENHSLALLGKK
KSSNLTLPPKYNQPFFVTSLPDDKIPKGAGPGCYLSGSLTLSKTELGKKAGQSAAKRQGK
FKKDVIPVHYYLISPPTKTKNGSKDKDKDSEKEKDLKEEFTEALRDLKIQWMTKLDSSDI
YNELKETYPNYLPLYVARLHQLDAEKERMKRLNEIVEAANAVISHIDQTALAVYIAMKTD
PRPDAAIIKNDMDKQKSTLVDALCRKGCALADHLLQAQEQEGAVSSDAEGREEEGEGTLD
SLTETFWETTKWTDLFDSKVLTFAYKHALVNKMYGRGLKFATKLVEEKPTKENWKNCIQL
MKLLGWTHCASFTENWLPIMYPPDYCVF
NT seq 3867 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgccgcgaccgaggagcccttccccttccacggcctcctcccaaagaaagag
accggggccgcttccttcctctgccgctacccggagtatgacgggcggggggtgctcatc
gccgtcctggacaccggggtcgaccccggggctccgggcatgcaggtcacaacggatgga
aaaccgaaaatcattgacatcattgacacgacgggaagtggtgacgtgaacacggccacg
gtagcagagcccaaggacggtgaactcattggcctttcgggaagagtgcttaagattcct
gcaagctggacaaatccctcaggcagataccacattggcataaaaaatggctatgatttc
tacccaaaggctctcaaggaaaggatacagaaagaacggaaggaaaaaatctgggaccct
gtacaccgagtggcccttgcagaagcctgtcgaaaacaggaagagtttgatgttgccaac
agttgcccttctcaagttggtgccagttgctttgatattctttcccattatagattatta
caagatattgaatgtagttccctgtgctatacagcaaataaactaatcaaggaggagctt
cagagtcaagtggagctgctcaactcttttgagaaaaagtatagtgatcctggccctgtg
tacgactgcttggtgtggcatgatggggagacctggagagcctgcattgattcgaatgaa
gatggggatttgagtaaatcgactgttttgagaaactacaaagaggcccaggaatatggt
tcttttggcacagctgagatgttgaattactccgttaacatttacgatgagggaaacctg
ctctccattgtgaccagtggaggagctcatggaacccacgtagctagtatcgctgccggg
cattttcccgaagaaccggagcggaatggcgtagcacctggtgctcagattctttccatc
aagattggtgacaccagactaagcacaatggaaacaggcacaggcctcatcagagctatg
atagaagttataaatcataagtgtgatcttgtcaactacagctatggagaagcaactcac
tggccaaattctgggagaatttgtgaagtaattagtgaagcagtgtggaagcataatata
atttatgtttcgagtgctggaaataacggtccctgcctttctacagtcgggtgtccaggt
ggaaccacatcaagtgtgataggggttggtgcctacgtttctcctgacatgatggttgcc
gagtactcgctgcgagagaagttacctgcaaaccagtacacgtggtcttccagaggcccc
agtgccgacggggccctgggcgtgagcatcagtgccccggggggagccatcgcctctgtc
cccaactggaccttgaggggaactcagctcatgaacgggacgtccatgtcttctcccaac
gcctgcgggggcatcgcactgattctctcaggtctgaaagctaacaatgctgattacacg
gttcattccgtcagaagagctctagaaaacacggcagtgaaggccgacaacatagaagtg
tttgcccaaggacacggtattatccaggttgataaagcctatgactacctcgttcagaac
acatcatttgctaataagttaggtttcactgttactgttggaaataaccgtggcatctac
ctccgagatcctattcaggtggctgcaccttcagatcatggcgttggcattgagcctgtg
tttccagaaaatactgaaaactctgaaaaaatatcccttcagcttcatttagctttaact
tcgaattcctcttgggttcagtgtcccagccacttggagctcatgaatcaatgtagacac
ataaacatacgtgtggatcccaggggcttgagagaaggattgcattacacagaggtctgt
ggctatgacacagcgtctccgaatgcaggccctctgttccgagtccccatcaccgcagtg
atagcagcaaaagtcaatgaatcatcccattatgacctagcctttaccgacgtacacttt
aaacctgggcagattcgaaggcattttattgaggttcctgagggtgcgacgtgggctgaa
gtcacggtgtgttcctgttcttctgaggtgtccgccaagtttgtccttcacgcagtgcag
cttgtgaagcagagagcgtaccgaagtcacgagttctacaagttttgttcccttccagag
aaaggaaccctgacagaagcttttcctgtcttaggtgggaaagcaattgagttttgcatt
gctcgttggtgggcaagtcttagtgacgtcaacattgattataccatttccttccacggg
atagtatgtactgctcctcagttaaacatccatgcatcagagggaatcaaccgttttgat
gttcagtcctccctgaaatatgaagatctggctccctgcataactttgaagagctgggtc
caaacgctacgtccactgagtgcaaaaacaaagcctttaggatcaagagatgttttgcca
aataatcgtcagctctatgagatgatcctgacatacaactttcatcaacccaagagtggg
gaggtcactccaagctgccccctgctttgtgaattattatacgagtcagaatttgacagc
cagctgtggattatatttgaccagaacaaaagacagatgggttccggcgatgcctatcct
catcagtattctttgaaactggagaaaggagattatacaattcgactacagattcgtcat
gagcaaatcagtgatttggagcgtcttaaagatcttccgtttattgtttctcataggttg
tctaataccttgagcttagatattcatgaaaatcatagccttgcacttctagggaagaag
aaatcaagtaacttgacattgccacccaaatataaccagccgttctttgttacttcctta
cctgatgacaagatacctaaaggggcaggaccgggttgctacctttcaggatccttaacg
ttgtcaaagaccgaacttggaaagaaagccgggcagtctgcagcaaaacgacaaggaaaa
tttaaaaaggatgtaatccctgttcactactacctgatatcgccaccaacaaagaccaag
aatggcagcaaggacaaagacaaagattctgaaaaagagaaggatttaaaagaagagttt
actgaagcgctacgagatcttaaaattcagtggatgacgaagctggattctagtgacatt
tacaatgaattgaaagaaacgtatccgaattatcttcctctctatgttgcacgacttcat
cagttggatgctgaaaaggaacgaatgaaaagacttaatgaaatcgttgaagctgcaaat
gctgttatttctcacatagatcaaacggccctagcagtttatattgcgatgaagactgac
cccaggcctgatgcagctattataaaaaatgacatggacaagcagaagtcgacgctcgtg
gacgccctctgtcggaaaggctgcgccctggccgaccacctcctccaggcccaggagcag
gagggggctgtgtcgagcgatgcggaagggagagaggaggagggcgagggcaccctggac
tccctgacggaaaccttctgggagaccaccaagtggaccgacctttttgacagcaaggtt
ttgacatttgcatacaagcatgcattggtaaataaaatgtatgggagaggccttaaattt
gcaactaaacttgtggaggaaaaaccaacaaaagaaaactggaaaaattgtattcaactg
atgaagctacttggatggacccattgtgcgtcttttactgaaaactggctccccatcatg
tatcctcctgattattgtgtattctaa

DBGET integrated database retrieval system