KEGG   Sus scrofa (pig): 100511316
Entry
100511316         CDS       T01009                                 
Symbol
GPC2
Name
(RefSeq) glypican-2
  KO
K08108  glypican 2
Organism
ssc  Sus scrofa (pig)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:ssc00535]
    100511316 (GPC2)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ssc00537]
    100511316 (GPC2)
Proteoglycans [BR:ssc00535]
 Cell surface proteoglycans
  Glypican family (GPI-anchored HSPG)
   100511316 (GPC2)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ssc00537]
 Others
  100511316 (GPC2)
SSDB
Motif
Pfam: Glypican
Other DBs
NCBI-GeneID: 100511316
NCBI-ProteinID: XP_003124388
Ensembl: ENSSSCG00000007649
UniProt: F1RNM8
Position
3:complement(8169229..8175848)
AA seq 577 aa
MYALRSLLLLLLPLCPGPGPGPGIEAKVTRSCIETRQILGARGYSLSLLPPALISGEHLR
ICPQEYTCCSSEIEQRLTWETETTFRGLVEENGSFLVHTLAARHRKFDDVFREMLSSAEH
SLSLLFHRSFGRLYAQHTLLFSGLFSRLRDYYERSGAGLDDALVDFWAQLLEKMFPLLHP
QYTFSPDYLFCLTRLASSADDSLKPFGDSPRRLRLQITRALVAARAFVQGLETGRDVVSE
TLKMPMSEGCRRAVMRLTGCPLCRGVPSLPPCRGFCLNVAHGCIGSQGLDPDWGPYLDGL
LLLAEKIQGPFSFELAAQSIGAKISEGLMHLQENSVGVSAQVFQECGSPQPTPARARRAP
APREEVSRLWSAAAAEERPATAAGSSLPQLVWELRERLSRVRGFWAGLPLAVCGDPRMAA
DLSQEASPCWTGAGQGRYLSPVVGGSQAQHLDNPELDAEASSPDLQTRRRRLKLRAATSR
MKAAAQGRDLEQEDWEDASGSGEGQHYADDWMAGAAAAAPPGRPLRPPRRDSAGGKGGNV
LIRHNQDRNRTGGTSIGFHAQPLLILFLSALALLGPR
NT seq 1734 nt   +upstreamnt  +downstreamnt
atgtacgctctgcgatctcttctgcttctgctgttgcctctgtgtcccggtcctggtcct
ggacctggtatcgaggcaaaggtcacccggagttgcattgagacccggcagatcctgggg
gcccggggatatagcttaagcctactccctcccgccctgatctcaggtgagcacctccgg
atctgtccccaggagtacacctgctgttccagtgaaatagagcagaggctgacctgggag
actgagaccaccttccgaggcctggtagaggagaacggctccttcttggttcacacactg
gctgcccggcacagaaaatttgatgatgtttttcgggagatgctgtcatcagctgagcac
tccctgtccctgctcttccaccgctccttcggccgcctgtatgcccagcacaccctctta
ttcagtggcctgttctctcggctacgggactactatgagaggtccggtgcggggttagat
gatgccttggtggatttctgggctcagctcctggagaaaatgttccccctgctacaccca
cagtacaccttctcccccgactacctgttctgcctcacacgcctggcctcctctgctgat
gactctctgaagcctttcggggactcaccccgccgcctccgcctgcagataactcgggcc
ctggtagctgcccgggcctttgtccagggcctggagactggaagagatgtggtcagcgaa
acgcttaagatgccgatgtccgaaggctgcaggcgggctgtgatgcgtctgacaggttgc
cccctttgccggggggtcccctcgctgccaccctgccggggcttctgcctcaacgtggcc
catggctgtatcggcagccagggattggatcctgactgggggccctacctggatggtctc
ctgctcctggctgagaagatccagggccccttttcctttgagttagcagcccagtccatc
ggggcgaagatctcagaaggtttgatgcatctgcaggaaaacagtgtgggggtgtcagcc
caggtgttccaggagtgtgggagcccccaacccacgccggcccgcgcccgccgagccccg
gccccccgggaagaggtgagccggctctggtcggcggcggcggcggaggagcggccggca
accgctgcgggctccagcctgccccagctggtgtgggagctccgcgagcggctgagccga
gtgagaggcttctgggccgggctgcccctggcggtgtgcggggacccccgcatggcggcg
gacctctcgcaggaggcgtcgccctgctggaccggagctgggcagggccggtacttgtca
cccgtggttgggggctcccaggctcagcacctcgacaacccagagctggatgcggaagcc
tcgagccccgaccttcagacgcggaggcggcggctgaagctgcgggcggccacgagcagg
atgaaggcggccgcccaaggacgcgacttggagcaggaggactgggaggacgctagcggc
tccggagagggacagcactatgcagatgactggatggctggggcagcagctgcggccccc
ccaggccggcctcttcgccctcctcgaagggatagtgctgggggtaaaggaggcaatgtc
cttatccgccacaaccaggacaggaacaggactggagggacatctattggttttcatgcc
caacctctcctcattctcttcctctcagccctcgccctgcttggacctcgataa

DBGET integrated database retrieval system