KEGG   Sus scrofa (pig): 100511484
Entry
100511484         CDS       T01009                                 

Gene name
WNT16
Definition
(RefSeq) protein Wnt-16
  KO
K01558  wingless-type MMTV integration site family, member 16
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04150  mTOR signaling pathway
ssc04310  Wnt signaling pathway
ssc04390  Hippo signaling pathway
ssc04550  Signaling pathways regulating pluripotency of stem cells
ssc04916  Melanogenesis
ssc04934  Cushing syndrome
ssc05010  Alzheimer disease
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05165  Human papillomavirus infection
ssc05200  Pathways in cancer
ssc05202  Transcriptional misregulation in cancer
ssc05205  Proteoglycans in cancer
ssc05217  Basal cell carcinoma
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100511484 (WNT16)
   04390 Hippo signaling pathway
    100511484 (WNT16)
   04150 mTOR signaling pathway
    100511484 (WNT16)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100511484 (WNT16)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100511484 (WNT16)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100511484 (WNT16)
   05202 Transcriptional misregulation in cancer
    100511484 (WNT16)
   05205 Proteoglycans in cancer
    100511484 (WNT16)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100511484 (WNT16)
   05226 Gastric cancer
    100511484 (WNT16)
   05217 Basal cell carcinoma
    100511484 (WNT16)
   05224 Breast cancer
    100511484 (WNT16)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100511484 (WNT16)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100511484 (WNT16)
   05022 Pathways of neurodegeneration - multiple diseases
    100511484 (WNT16)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100511484 (WNT16)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ssc00536]
    100511484 (WNT16)
Glycosaminoglycan binding proteins [BR:ssc00536]
 Heparan sulfate / Heparin
  Morphogens
   100511484 (WNT16)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100511484
NCBI-ProteinID: XP_003134784
Ensembl: ENSSSCG00000016617
UniProt: F1SJF8
Position
18
AA seq 362 aa
MDRAALLGLSRLCALWAALLALFPCGAQGNWMWLGIASFGVPEKLGCANLPLNSRQKELC
KRKPYLLPSIREGARLGIQECRSQFKHERWNCLVATASQQGTSPLFGYELSSGTKETAFI
YAVMAAGLVHSVTRSCSAGNMTECSCDTTLQNGGSASEGWHWGGCSDDVQYGMWFSRRFL
DFPIRNTTGKESKVLLAMNLHNNEAGRQAVAKLMSLDCRCHGVSGSCAVKTCWKTMSSFE
KIGHLLKDKYENSVQISDKIKKKMLRRDKDQRKIPIRKDDLLYVNKSPNYCVEDKKLGIP
GTQGRECNRTSEGADGCNLLCCGRGYNTHVVRHVERCECKFIWCCYVRCRRCESMTDVHT
CK
NT seq 1089 nt   +upstreamnt  +downstreamnt
atggacagagcagcgctcctgggactgtcccgcctgtgcgcgctgtgggcagccctgctc
gcgctgtttccctgcggagcccaaggaaactggatgtggttgggcatcgcctcctttggg
gttccggagaagctgggctgcgccaacttgccgctgaacagccgccagaaggagctgtgc
aagaggaaaccgtacctgctgccgagcatccgcgagggtgcccgcctgggcatccaggaa
tgcaggagccagttcaaacatgagagatggaactgcctggtggccaccgcctcccagcag
ggcaccagccccctcttcggctacgagctgagcagcggcaccaaggaaacagcatttatt
tatgctgtgatggctgcaggcctggtgcattctgtgaccaggtcatgtagtgcaggcaac
atgacggagtgttcctgtgacaccaccttgcagaatggcggctcagcgagtgaaggctgg
cactgggggggctgctctgatgatgttcagtatggcatgtggttcagcagaaggttccta
gatttccccatcagaaacaccacgggaaaagagagcaaagtactgttagcaatgaaccta
cataacaatgaagctggaaggcaggctgtcgccaagctgatgtcactagactgccggtgt
cacggagtttccggctcctgtgctgtgaaaacgtgttggaaaaccatgtcttcttttgaa
aagattggccatctgttgaaggacaaatacgaaaacagcgtccaaatctcagacaagata
aagaagaaaatgctcaggagagacaaagatcagaggaaaatacccatccgcaaggatgat
ctgctctacgttaataaatctcccaattactgtgtagaggataagaaactagggatccca
gggacccagggcagggagtgcaaccgcacctcagagggtgcggatggctgtaaccttctc
tgctgtggcagaggctacaacacccacgtggtcaggcacgtggagagatgcgagtgcaag
tttatctggtgctgctacgtccgttgcaggaggtgtgaaagcatgactgacgtccacact
tgcaagtag

DBGET integrated database retrieval system