KEGG   Sus scrofa (pig): 100511655
Entry
100511655         CDS       T01009                                 

Gene name
B4GALT1
Definition
(RefSeq) beta-1,4-galactosyltransferase 1
  KO
K07966  beta-1,4-galactosyltransferase 1 [EC:2.4.1.22 2.4.1.90 2.4.1.38 2.4.1.-]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00052  Galactose metabolism
ssc00510  N-Glycan biosynthesis
ssc00513  Various types of N-glycan biosynthesis
ssc00514  Other types of O-glycan biosynthesis
ssc00515  Mannose type O-glycan biosynthesis
ssc00533  Glycosaminoglycan biosynthesis - keratan sulfate
ssc00601  Glycosphingolipid biosynthesis - lacto and neolacto series
ssc01100  Metabolic pathways
Module
ssc_M00071  Glycosphingolipid biosynthesis, neolacto-series, LacCer => nLc4Cer
ssc_M00075  N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100511655 (B4GALT1)
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    100511655 (B4GALT1)
   00513 Various types of N-glycan biosynthesis
    100511655 (B4GALT1)
   00515 Mannose type O-glycan biosynthesis
    100511655 (B4GALT1)
   00514 Other types of O-glycan biosynthesis
    100511655 (B4GALT1)
   00533 Glycosaminoglycan biosynthesis - keratan sulfate
    100511655 (B4GALT1)
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    100511655 (B4GALT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ssc01003]
    100511655 (B4GALT1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ssc04131]
    100511655 (B4GALT1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ssc04147]
    100511655 (B4GALT1)
Enzymes [BR:ssc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.22  lactose synthase
     100511655 (B4GALT1)
    2.4.1.38  beta-N-acetylglucosaminylglycopeptide beta-1,4-galactosyltransferase
     100511655 (B4GALT1)
    2.4.1.90  N-acetyllactosamine synthase
     100511655 (B4GALT1)
    2.4.1.-  
     100511655 (B4GALT1)
Glycosyltransferases [BR:ssc01003]
 Glycan extension
  Type 2 chain/Poly-N-acetyllactosamine
   100511655 (B4GALT1)
Membrane trafficking [BR:ssc04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Acrosomal exocytosis proteins
    100511655 (B4GALT1)
Exosome [BR:ssc04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   100511655 (B4GALT1)
SSDB
Motif
Pfam: Glyco_transf_7N Glyco_transf_7C Glyco_tranf_2_2
Other DBs
NCBI-GeneID: 100511655
NCBI-ProteinID: XP_003130728
Ensembl: ENSSSCG00000010998
UniProt: A0A287BG16
Position
10
AA seq 401 aa
MRFREPLLGGSAATMPGASLQRACRLLVAVCALHLGVTLIYYLTGRDLSRLPQLVGVPTP
LQGGSNSAAAIGQPSGELRPRGAAPQPPLRASSKPSSGGDSSPDADSRPGPGPASNLTSA
PVPSTAARLPPACPEESPLLVGPMLIEFNMAVDLKLVEKQNPEVNMGGHYTPKDCTSPHK
VAIIIPFRNRQEHLKYWLYYLHPILQRQQLDYGVYVINQAGESMFNRAKLLNVGFKEALK
DYDYNCFVFSDVDLIPMNDHNAYRCFSQPRHISVAMDKFGFSLPYVQYFGGVSALSKEQF
LTINGFPNNYWGWGGEDDDIFNRLAFKGMSVSRPNAMIGKCRMIRHSRDKKNEPNPQRFD
RIAHTKETMLSDGLNTLTYLVLDIERYPLFTKITVDIGTPS
NT seq 1206 nt   +upstreamnt  +downstreamnt
atgaggtttcgggagccgctcctgggcggcagcgccgcgacgatgccgggcgcgtccttg
caacgggcctgccgcctgctcgtggctgtctgcgcgctgcatcttggcgtcaccctcatc
tactacctgactggccgcgacctaagccgcctgcctcagctggtcggggtccccacaccg
ctgcagggcggctctaacagcgccgccgccatcgggcagccctccggggagctccggccc
cgaggggccgcaccgcagccgcctttgcgcgcctcctccaagccgagctcgggtggcgac
tccagcccagacgcagactctcgcccgggcccgggacccgccagcaacttgacttcggcc
ccagtgccctccaccgcagcacggttgccgcccgcatgccctgaggagtccccgctgctc
gtcggccccatgctgattgagtttaacatggccgtggacctgaagcttgtggagaaacag
aacccggaggtgaatatgggtggtcactacacccccaaggactgcacctctcctcacaag
gtggctatcatcattccattccgcaatcggcaggaacacctcaagtattggctgtattac
ttgcacccaatcctacagcgtcagcagttggactatggcgtctatgttatcaaccaggct
ggagaatccatgttcaaccgtgcaaagctcctcaacgtcggctttaaagaggccttgaag
gactatgactacaactgctttgtgtttagcgacgtggacctcattccaatgaatgaccac
aatgcctacaggtgtttctcacagccacggcacatttctgtagcaatggataagtttgga
tttagcctcccttatgtgcagtatttcggcggtgtctctgctctaagtaaagaacagttt
ctcaccatcaatggatttcctaataactattggggctggggaggtgaagatgatgacatt
tttaacagattagcttttaaaggcatgtccgtatctcgcccaaatgctatgatcgggaaa
tgccggatgatccgccactcaagagacaagaaaaatgaacctaatcctcagaggtttgac
cgaattgcacacaccaaggagaccatgctctctgatggcttgaacacactcacctacctg
gtgttggacatagagagatacccgttatttaccaaaatcacagtggacatcgggacaccg
agctag

DBGET integrated database retrieval system