KEGG   Sus scrofa (pig): 100511878
Entry
100511878         CDS       T01009                                 

Gene name
PIAS3
Definition
(RefSeq) E3 SUMO-protein ligase PIAS3 isoform X1
  KO
K16064  E3 SUMO-protein ligase PIAS3 [EC:2.3.2.-]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04120  Ubiquitin mediated proteolysis
ssc04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100511878 (PIAS3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100511878 (PIAS3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ssc04121]
    100511878 (PIAS3)
Enzymes [BR:ssc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     100511878 (PIAS3)
Ubiquitin system [BR:ssc04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   100511878 (PIAS3)
SSDB
Motif
Pfam: PINIT zf-MIZ zf-Nse
Other DBs
NCBI-GeneID: 100511878
NCBI-ProteinID: XP_003125840
Ensembl: ENSSSCG00000006689
UniProt: F1SDD9
Position
4
AA seq 628 aa
MAELGELKHMVMSFRVSELQVLLGFAGRNKSGRKHELLAKALHLLKSSCAPSVQMKIKEL
YRRRFPRKTLGPSDLSLLSLPPGTPPVGSPGPLAPIPPALLAPGTLLGPKREVDMHPPLP
QPVHPDVTMKPLPFYEIYGELIRPTTLASTSSQRFEEAHFTFALTPQQVQQILTSREVLP
GAKCDYTIQVQLRFCLCETSCPQEDYFPPNLFVKVNGKLCPLPGYLPPTKNGAEPKRPSR
PINITPLARLSATVPNTIVVNWSSEFGRNYSLSVYLVRQLTAGTLLQKLRAKGIRNPDHS
RALIKEKLTADPDSEVATTSLRVSLMCPLGKMRLTVPCRALTCAHLQSFDAALYLQMNEK
KPTWTCPVCDKKAPYESLIIDGLFMEILNSCSDCDEIQFMEDGSWCPMKPKKEASEVCPP
PGYGLDGLQYSPVQEGNSSDNKKKVEVIDLTIESSSDEEDLPPTKKHCPVTSAAIPALPG
SKGVLTSGHQPSSVLRSPAMGTLGGDFLSSLPLHEYPPAFPLGADIQGLDLFSFLQTESQ
HYGPSVITSLDEQDALGHFFQYRGTPSHFLGPLAPTLGSSHRSTTPAPPPGRVSNIVAPG
GTLREGHGGPLPSGPSLTGCRSDIISLD
NT seq 1887 nt   +upstreamnt  +downstreamnt
atggcggagctgggcgaattaaagcacatggtgatgagtttccgggtgtctgagctccag
gtgctcctcggctttgctggccggaacaagagtggacggaagcacgagctcctggccaag
gccctgcacctcctcaagtccagctgtgcccccagtgtccagatgaagatcaaagagctt
taccgccgacgctttccccggaagaccctggggccctcagatctttccttgctctctctg
ccccctggcacccctcctgtaggctcccctggtcctctagctcccatccccccggccctc
ttggcccccggtaccctgctgggccccaagcgtgaagtggacatgcatccccctctgcct
cagcctgtgcaccctgatgtcaccatgaaaccattgcccttctatgaaatctacggggag
ctcatccggcccaccaccctcgcctccacttctagccagcggtttgaggaagcgcacttc
acctttgccctcaccccccagcaagtgcagcagattctcacatccagagaggttctgcca
ggagccaaatgcgattataccatacaggtgcagctccggttctgtctctgtgagaccagc
tgcccgcaggaggattatttccctcctaacctctttgtcaaggtcaatgggaaactgtgc
cccctaccgggttacctcccccctaccaagaatggggctgagcccaagagacccagccgt
cccatcaacatcacacccttggctcgactctcggccactgttcccaacaccatcgtggtc
aactggtcatctgagtttggacggaattactccttgtctgtgtacctggtgaggcagctg
accgcagggactcttctacaaaaactcagagcaaagggcatccggaacccagaccattcc
cgagcactgatcaaggagaaattgaccgctgacccagacagtgaggtggccactacgagt
ctccgggtgtcactcatgtgcccgctagggaagatgcgcttgactgtcccttgtcgtgcc
ctcacctgcgcccacctgcagagcttcgatgctgccctttatctacagatgaatgagaag
aagccaacatggacgtgtcctgtgtgtgacaagaaggctccctatgaatctcttatcatt
gatgggttatttatggagattcttaattcctgctcggattgtgatgagatccaattcatg
gaagacggatcctggtgcccaatgaaacccaaaaaggaggcatctgaggtttgccccccg
ccagggtatgggctggatggcctccagtatagcccagtgcaagaaggcaattcatcagat
aataaaaagaaggttgaagttattgacttgacaatagaaagctcatcagacgaggaggac
ctacccccgaccaagaagcactgtcctgtcacctcagctgctatcccggctctacctgga
agcaaaggagtcctgacatcgggtcaccagccatcttcggtgctacggagccctgctatg
ggcacgctgggcggggacttcctgtccagcctccccctacatgagtacccacctgccttc
ccactgggggctgatatccaaggtttagatttattttctttccttcagactgagagtcag
cactatggcccctccgtcatcacgtcgctagatgaacaggatgcccttggtcacttcttc
cagtaccgagggaccccttcccacttcctgggcccgctagcccccacactggggagctct
caccgcagcaccactccagcaccccctcctggccgtgtcagtaacattgtggcccctggg
gggaccttaagggaggggcatggaggacccctgccctctgggccctctttgacaggctgt
cgctcagacatcatttccctggactga

DBGET integrated database retrieval system