KEGG   Sus scrofa (pig): 100511997
Entry
100511997         CDS       T01009                                 

Gene name
CLCN6
Definition
(RefSeq) LOW QUALITY PROTEIN: chloride transport protein 6
  KO
K05015  chloride channel 6
Organism
ssc  Sus scrofa (pig)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ssc04040]
    100511997 (CLCN6)
Ion channels [BR:ssc04040]
 Chloride channels
  Chloride channel (CLC)
   100511997 (CLCN6)
SSDB
Motif
Pfam: Voltage_CLC CBS
Other DBs
NCBI-GeneID: 100511997
NCBI-ProteinID: XP_005665054
Ensembl: ENSSSCG00000003429
UniProt: A0A481AIE6 A0A4X1W2C6
Position
6
AA seq 870 aa
MAGCRGSLCCCCRWCCCCGERETRTPEELTILGETQEEEDEILPRKDYESLDYDRCINDP
YLEVLETMDNKKGRRYEAVKWMMVFAIGVSTGLVGLFVDFFARLFTQLKFGVVQASVEEC
SQKGCLALSLLELMGFNLTFVFFASLLVLIEPVAAGSGIPEIKCYLNGVKVPGIVRLRTL
LCKVFGVLFSVAGGLFVGKEGPMIHSGSVVGAGLPQFQSISLRKIQFNFPYFRSDRDKRD
FVSAGAAAGVAAAFGAPIGGTLFSLEEGSSFWNQGLTWKVLFCSMSATFTLNFFRSGIQF
GSWGSFQLPGLLNFGEFKCSDSDKKCHLWTAMDLGFFVVMGVTGGLLGATFNCLNKRLAK
YRMRNVHPKPKLVRVLESLLVSLVTTVVVFVASMVLGECRQMSSAGQVGNDSFQLQVTSE
DVNSSIKTFFCPNETYNDMATLFFNPQESAILQLFHQDGTFSPITLALFFVLYFVLACWT
YGISVPSGLFVPSLLCGAAFGRLVANVLKSYIGLGHIYSGTFALIGAAAFLGGVVRMTIS
LTVILIESTNEITYGLPIMITLMVAKWTGDFFNKGIYDIHVGLRGVPLLEWETEVEMDKL
RASDIMEPNLTYVYPHTRIQSLVSILRTTVHHAFPVVTENRGNEKEFMKGNQLISNNIKF
KKSSILTRAGEQRRRSQSMKSYPSSELRNMCDEHVTAEDPGEKEDLLQQMLERRYTPYPN
LYPDQSPSEDWTMEERFRPLTXHGLILRSQLVTLLVRGVCYSESQSSASQPRLSYAEMAE
DYPRYPDIHDLDLTLLNPRMIVDVTPYMNPAPFTVSPNTHVSQVFNLFRTMGLRHLPVVN
AVGEIVGVITRHNLTYEFLQARLRQHYQTL
NT seq 2613 nt   +upstreamnt  +downstreamnt
atggcggggtgcagggggtccctctgctgctgctgcaggtggtgctgctgttgtggtgag
cgtgagacccgcactcccgaggagctgaccatccttggagaaacacaggaagaggaggat
gagatccttccaaggaaagactatgagagtttggattatgatcgctgtatcaatgaccct
tacctggaagttttggagaccatggataataagaaaggtcgcaggtatgaggcggtgaag
tggatgatggtgtttgccattggagtctccactgggctggtgggtctcttcgtggacttc
tttgcgcgcctcttcacccagctcaagttcggagtggtgcaggcctcggtggaggaatgc
agccagaaaggctgcctcgccctgtccctccttgaactcatgggtttcaacttgaccttt
gtcttcttcgccagccttcttgttctaatcgagccagtggctgcaggttctgggataccc
gagatcaaatgctacctgaatggtgtgaaggtgccgggaatcgtccgtctgcggaccctg
ctctgcaaagtcttcggagtgctgttcagtgtggctggagggctctttgtggggaaggaa
ggcccaatgatccacagtgggtcggtggtgggcgctggcctcccgcagtttcagagcatc
tccctgcggaagatccagtttaacttcccctacttccgaagtgacagggacaagcgggac
tttgtgtcagcaggggcagccgcgggagtcgctgcagcttttggggcccccattgggggt
accttgttcagtctggaggagggctcgtccttctggaaccaggggctcacgtggaaagtg
ctcttttgttccatgtctgccaccttcactctcaacttctttcgttctgggattcagttt
ggaagttggggttccttccagctccctggattgctgaacttcggcgagtttaagtgctct
gactctgataaaaaatgtcatctctggacagctatggacttggggttcttcgtcgtgatg
ggggtcactgggggcctcctgggagccacattcaactgtctgaacaagaggcttgcaaag
taccgcatgcgaaacgtgcacccgaaacctaagctcgtcagggtcttggagagcctcttg
gtgtccctggtgaccaccgtggtggtgtttgtggcctccatggtgttgggagagtgccga
cagatgtcttcggcggggcaagtcggcaacgactccttccagctccaggtcacatcagag
gatgtgaattcaagtatcaagaccttcttttgtcccaacgagacctacaatgacatggcc
acactcttcttcaatccccaggagtcggccatcctccagctcttccaccaggatggcact
tttagccccatcactttggccttgttcttcgtcctctatttcgtacttgcgtgttggact
tacggcatttctgttcccagtggcctttttgtgccttctctgctgtgtggagctgctttt
ggacgtttagttgccaatgtcctcaaaagctacattggactgggtcacatctactccggg
acctttgccctgattggcgccgcagctttcttgggcggggtcgtccgaatgaccatcagc
ctcacggtcatcctgatcgagtcgaccaacgagatcacctacggccttcccatcatgatc
accctgatggtggccaagtggaccggggactttttcaacaagggcatttacgacatccac
gtgggcctgagaggcgtgccacttctggaatgggagacggaggtggagatggacaaactg
cgagccagcgacatcatggagcccaacctgacctatgtctacccgcacacccgcatccag
tctctggtcagcatcctgcgcaccacggtccaccacgccttcccggtggtcacggagaat
cggggcaacgagaaggagttcatgaagggcaaccagctcatcagtaacaacatcaagttc
aagaagtccagcatcctcacccgcgccggcgagcagcgcaggcggagccagtccatgaag
tcctacccgtccagcgagctgcggaacatgtgcgacgagcatgtgaccgctgaggatccg
ggcgagaaggaggacctcctgcagcagatgctggagcggagatacactccctaccccaac
ctataccctgaccagtccccgagtgaagactggaccatggaggagcgcttccgcccgctg
accnttcacggcctgatcctgcgctcgcagctcgtcaccctgctcgtccgaggagtttgt
tactctgaaagccagtcaagcgccagccagccgcgcctctcctacgctgagatggccgag
gactacccgcggtaccctgacatccacgacctggacctgaccctgctgaacccgcgcatg
atcgtggatgtcaccccatacatgaaccctgcacccttcactgtctcccccaacacccac
gtctcccaagttttcaacctgttccggacgatgggcctgcggcacttgcccgtggtgaat
gcggtgggagagatcgttggggtcatcacgcgacacaacctgacgtacgagtttctgcag
gcccggctgcggcagcattaccagactctctga

DBGET integrated database retrieval system