KEGG   Sus scrofa (pig): 100512157
Entry
100512157         CDS       T01009                                 

Symbol
MXD3
Name
(RefSeq) max dimerization protein 3
  KO
K09114  MAX dimerization protein
Organism
ssc  Sus scrofa (pig)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ssc03000]
    100512157 (MXD3)
Transcription factors [BR:ssc03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Mad/Max
    100512157 (MXD3)
SSDB
Motif
Pfam: HLH DUF3829 T3SS_needle_E Exonuc_VII_L MSP1_C PXA Spc7 Zwint
Other DBs
NCBI-GeneID: 100512157
NCBI-ProteinID: NP_001231033
Ensembl: ENSSSCG00000014041
UniProt: F1S3C4 A0A4X1SFF8
Position
2
AA seq 206 aa
MEPVASNIQVLLQAAEFLERREREAEHGYASLFPHRSPGPVHRRRRRSPQDPGALDSGRS
VHNELEKRRRAQLKRCLEQLKQQMPLGADCARYTTLSLLRRARMHIQKLEEQEQRARRLK
EKLRSKQQSLRQQLEQLRGLAGPGERERLRADSLDSSGLSSERSDSDQEELEVDVESLVF
GGEAELLRGFSAGQEHSYSHGGGVWL
NT seq 621 nt   +upstreamnt  +downstreamnt
atggaacccgtggccagcaatatccaagttctgctgcaggcggccgagttcctggagcgc
cgcgagagagaggcggagcatggctatgcgtccctgtttccgcaccgaagtcctggcccg
gtccacaggaggaggcggcggtccccccaagatcctggcgcgctggacagtgggcggtct
gtgcataacgagttggaaaagcgcaggagggcccagctgaagcggtgcctggagcagctg
aagcagcagatgcccctgggggctgactgtgcccgatacaccacactgagccttctgcgc
agggccaggatgcacatccagaaactggaggagcaggagcagcgggcccggcggctcaag
gagaagcttcgaagtaagcagcagagcctgcggcagcagctggagcagctcagggggctt
gcggggcctggtgagcgtgagcggctgcgggcagacagcctggactcctcaggcctctcc
tccgagcgttctgactcagaccaagaggagctggaggtggatgtggagagcctggtgttc
gggggcgaggctgagctgctacggggcttcagcgccggccaggagcacagctattcacac
ggtggtggcgtctggctatga

DBGET integrated database retrieval system