KEGG   Sus scrofa (pig): 100512285
Entry
100512285         CDS       T01009                                 

Gene name
CEACAM1
Definition
(RefSeq) carcinoembryonic antigen-related cell adhesion molecule 1 isoform X1
  KO
K06499  carcinoembryonic antigen-related cell adhesion molecule
Organism
ssc  Sus scrofa (pig)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ssc04147]
    100512285 (CEACAM1)
   04090 CD molecules [BR:ssc04090]
    100512285 (CEACAM1)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ssc00537]
    100512285 (CEACAM1)
Exosome [BR:ssc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100512285 (CEACAM1)
  Exosomal proteins of bladder cancer cells
   100512285 (CEACAM1)
CD molecules [BR:ssc04090]
 Proteins
  100512285 (CEACAM1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ssc00537]
 Antigens
  100512285 (CEACAM1)
SSDB
Motif
Pfam: Ig_3 I-set V-set ig Ig_2 Ig_4 Izumo-Ig Ig_6 Podoplanin V-set_CD47 VSP Ig_7 Adeno_E3_CR1 C2-set_2 Big_9
Other DBs
NCBI-GeneID: 100512285
NCBI-ProteinID: XP_005655946
Ensembl: ENSSSCG00000020837
UniProt: I3L9E5
Position
6
AA seq 438 aa
MEPPSAPAHRGHVPWHRLLLAVSLLSFWNLPATAQITIESVPFNVAEGSDVLLLAHNATE
DTLGYSWYRGERVENNQLIVTYRIDTQAYTQGPTFSGRERIYPNGSLLFQNATQNDTGYY
TLMVTKNDLQREIVTGLLRVYPVLPRPIITSNNPNPVEHEDTVVLTCEPETQHTTYRWWI
NNQSLSNSTRLQLSEDNRTLTLFNVTRNDTGPYECETQNPVSATRSDPFTLNVIHPVAKP
IVEANSTTVTEHEDTVVLKCLTNDTGVSLRWLFNGQSLLLAERIKLSQDNGTLTIEPVRR
EDAGNYQCEASNLGNSNKSDPLRLDVKFDSAPGSSSGLSGGAIAGIVIGVLAGVALIAGL
VYFLFIRKIGGASDQRQLTENKSSDFNHIQDHSDKLSKKIDEVTYSSLNFNAQESKKPTS
ALPSPSATETVYSEVKKK
NT seq 1317 nt   +upstreamnt  +downstreamnt
atggagcccccctcagcccctgcccacagagggcatgtcccctggcacaggctcctgctg
gcagtctcactcctaagcttctggaacttgcccgccactgcccagatcactattgaatca
gtgcccttcaatgtcgcagaaggaagcgatgttcttctacttgcccacaatgcgacagag
gatactctaggctacagctggtacagaggagaaagagtagagaacaaccaactaattgta
acatacagaatagacactcaagcatatacccaaggacctacattcagtggtcgagagaga
atctaccccaatggatccctgctgttccagaatgccacccagaatgacacaggatactac
actctgatggttacaaagaatgatttacagagagaaattgtaactggactactccgtgta
tacccggtgttacccaggcccatcatcaccagcaacaaccccaaccccgtggagcacgag
gacactgtggtgttaacatgtgaacctgagactcagcacacaacctacaggtggtggatc
aacaaccagagcctctccaacagcaccaggctgcaactgtctgaggacaacaggacactc
actttattcaacgtcaccagaaatgacacaggaccctatgagtgtgaaacccagaaccca
gtgagtgccacccgcagtgacccattcaccctgaatgttatccacccagtggcaaagccc
atcgtcgaagccaacagcaccaccgtcacagaacacgaggacactgtggtcctgaaatgc
ctcacaaatgacaccggggtctccttacgctggctcttcaatggccagagcctactgctc
gcagagaggataaaactgtcccaggacaatggcaccctcaccatagagcccgtcaggagg
gaggatgctgggaattatcagtgcgaggcctccaacctgggcaattccaacaaaagtgac
cccctcaggctggatgtgaaatttgattcagcaccaggaagttcttctggcctctcaggt
ggtgctattgctggcatcgtgatcggagtcctggctggggtagctctgatagcaggcctg
gtgtatttcctgtttatcagaaaaattggaggggcaagtgaccagcgccaactcacagag
aacaaatcctcagacttcaaccacattcaggaccactctgacaaactgtccaagaagatt
gatgaagttacatactcttccctgaacttcaatgcccaggaatcaaagaaacctacttca
gcacttccatctccatcagccacagaaacagtttattcagaagtgaaaaagaagtaa

DBGET integrated database retrieval system