KEGG   Sus scrofa (pig): 100512494Help
Entry
100512494         CDS       T01009                                 

Gene name
PFN1
Definition
(RefSeq) profilin-1
  KO
K05759  profilin
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04015  Rap1 signaling pathway
ssc04810  Regulation of actin cytoskeleton
ssc05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    100512494 (PFN1)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100512494 (PFN1)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    100512494 (PFN1)
Membrane trafficking [BR:ssc04131]
 Others
  Actin-binding proteins
   Others
    100512494 (PFN1)
Cytoskeleton proteins [BR:ssc04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     100512494 (PFN1)
Exosome [BR:ssc04147]
 Exosomal proteins
  Proteins found in most exosomes
   100512494 (PFN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Profilin
Motif
Other DBs
NCBI-GeneID: 100512494
NCBI-ProteinID: NP_001231345
Ensembl: ENSSSCG00000017905
UniProt: F1RFY1
Position
12
AA seq 140 aa AA seqDB search
MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFF
VNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTFNITVTMTAKTLVLLMGKEGVH
GGMINKKCYEMASHLRRSQY
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggccgggtggaacgcctacatcgacaacctcatggcggacgggacctgtcaggacgcg
gccatcgtgggctataaggactcgccctccgtctgggccgccgtccccgggaaaaccttc
gtcaacatcacgccagctgaggttggtgtcctggttggcaaagaccggtcaagttttttc
gtgaatgggctaacgcttgggggccagaaatgctctgtgatccgggactcactgctgcag
gacggggaatttaccatggatcttcgtaccaagagcactggcggagcccccaccttcaat
atcactgtcaccatgactgccaagacgctagtcctgctgatgggcaaagaaggtgtccac
ggtggtatgatcaacaagaaatgttatgaaatggcttcccacctgcggcgttcccagtac
tga

DBGET integrated database retrieval system