KEGG   Sus scrofa (pig): 100512588
Entry
100512588         CDS       T01009                                 

Gene name
JMJD4
Definition
(RefSeq) jmjC domain-containing protein 4 isoform X1
Organism
ssc  Sus scrofa (pig)
SSDB
Motif
Pfam: Cupin_8 JmjC Cupin_4
Other DBs
NCBI-GeneID: 100512588
NCBI-ProteinID: XP_003123657
Ensembl: ENSSSCG00000013983
UniProt: F1S5T5 A0A4X1UHJ0
Position
2
AA seq 424 aa
MDRQMRAFAESHFRGLQGGLSSNVSPKLDHVDFIENPDSFSYADFFKGYLLPNLPCVFSS
AFTEGWGSRRLWVTPSGKPNFDYLLQNYGDVVVPVANCGVREYNSNPKEHMPLKDYISYW
KEYIQGNYSSSRGCLYLKDWHLCRDSSAESVFTLPIYFSSDWLNEYWDALDVDDYRFIYM
GPTGTWSPFHADIFRSFSWSVNICGRKKWFFFPPGQEEALRDCHGGLPYDVTSPTLLDSR
LHPVLNRCSPPLEVTQEAGEMVFVPSGWHHQVHNLEDTISINHNWVNGCNLANMWHFLQQ
ELCAVQQEIIEWRDTMPDWHHHCQVIMRSCSGINFEEFYHFLKVIAERRLLFLAKGVGPG
KVECGKSTGLGPQQAAFDVSRIAEVLKSVLAHPDFQRMDTSTFSPQPEELLQQLEEVVAA
TTSL
NT seq 1275 nt   +upstreamnt  +downstreamnt
atggacagacagatgcgcgcatttgccgagagccacttccgaggcctccagggaggtctc
tccagcaatgtcagcccgaaactggaccacgtggacttcatagagaatccagactccttt
tcctacgccgacttcttcaagggctatctgctccccaacttgccctgtgttttctccagc
gctttcaccgagggctggggcagcaggaggctctgggtgacgccaagcggaaagcccaat
tttgattatctgcttcagaactatggagatgtggttgtacctgttgcaaactgtggggtg
agggaatacaactccaaccccaaagaacacatgcccctcaaagactacatcagctactgg
aaagagtacattcagggaaactactcatcttcacggggctgtctctatctcaaagactgg
catctgtgcagggactcctcggcggagagcgtgttcaccctgcccatatacttctcgtca
gactggctcaacgagtactgggatgctctggacgtggatgactaccgcttcatctacatg
ggccccaccggcacctggtcgccgttccatgccgacattttccgctccttcagctggtct
gtcaacatttgtgggaggaaaaagtggttcttcttcccaccggggcaagaagaagccctg
cgggattgccatggtggcctcccctatgacgtgacctcccctacactcctggatagccgc
ctacaccccgtgctcaatcgctgtagcccaccactggaggtcacacaggaagccggcgag
atggtatttgtgcccagtgggtggcaccaccaagtccacaacctggaggacaccatctcc
atcaaccacaactgggtcaacggctgtaacctggccaacatgtggcacttcctgcagcag
gagctctgtgctgtgcagcaggagatcattgagtggagggacaccatgcctgattggcac
caccactgccaggtcatcatgaggtcctgctccgggattaattttgaggaattctatcac
tttctcaaggtcatcgctgaaaggaggcttctctttctggcaaagggagtgggccctggc
aaagtggagtgtggcaagagcactgggctaggcccccagcaggctgcttttgatgtcagc
cgcatagctgaggtgctcaagtctgtgttggcccaccctgacttccagagaatggatacc
agtacattctccccacagccagaggaactgctgcagcagctggaggaggttgtggccgcc
accacatccctttag

DBGET integrated database retrieval system