KEGG   Sus scrofa (pig): 100512624
Entry
100512624         CDS       T01009                                 

Gene name
ATP5H
Definition
(RefSeq) ATP synthase subunit d, mitochondrial
  KO
K02138  F-type H+-transporting ATPase subunit d
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00190  Oxidative phosphorylation
ssc01100  Metabolic pathways
ssc04714  Thermogenesis
ssc05010  Alzheimer disease
ssc05012  Parkinson disease
ssc05014  Amyotrophic lateral sclerosis
ssc05016  Huntington disease
ssc05020  Prion disease
Module
ssc_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    100512624 (ATP5H)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    100512624 (ATP5H)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100512624 (ATP5H)
   05012 Parkinson disease
    100512624 (ATP5H)
   05014 Amyotrophic lateral sclerosis
    100512624 (ATP5H)
   05016 Huntington disease
    100512624 (ATP5H)
   05020 Prion disease
    100512624 (ATP5H)
SSDB
Motif
Pfam: Mt_ATP-synt_D
Other DBs
NCBI-GeneID: 100512624
NCBI-ProteinID: NP_001231613
UniProt: A0A4X1V3L8 A0A287A2Y4
Structure
PDB: 
6J5I 6J5J 6J54 6J5A

Position
12
AA seq 161 aa
MAGRKLALKAIDWVAFGEIIPRNQKAIANSLKSWNETLSTRLAALPEKPPAIDWAYYKAT
VAKAGLVDDFEKKFNALKVPVPEDKYTALVDAEEQEDVKRCAEFLSLSKARIEAYEKELE
KMKNIIPFDQMTIEDLNEVFPETKLDKKKYPYWPHRPIESL
NT seq 486 nt   +upstreamnt  +downstreamnt
atggctgggcggaaacttgctctaaaagccattgactgggtagcctttggggagatcata
ccccgaaaccagaaggccattgctaactccctgaaatcctggaatgagaccctctccacc
aggttggctgctctacctgagaagccacctgctattgactgggcttactacaaggccacc
gtggcaaaggctggcttggtagatgactttgagaagaagtttaatgccctgaaggtccct
gtgccagaggataaatacactgctctggtggatgctgaagagcaagaagatgtgaaaaga
tgtgctgagtttttgtctctctcaaaggccaggattgaggcatatgagaaagagctggag
aagatgaagaacataattccatttgatcagatgaccatcgaggacttgaatgaagtcttc
ccagaaaccaaactagacaagaagaagtatccctactggcctcacaggccaattgagagt
ttataa

DBGET integrated database retrieval system