KEGG   Sus scrofa (pig): 100512775Help
Entry
100512775         CDS       T01009                                 

Gene name
ST6GAL2
Definition
(RefSeq) beta-galactoside alpha-2,6-sialyltransferase 2
  KO
K00779  beta-galactoside alpha-2,6-sialyltransferase (sialyltransferase 2) [EC:2.4.99.1]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00510  N-Glycan biosynthesis
ssc00514  Other types of O-glycan biosynthesis
ssc01100  Metabolic pathways
Module
ssc_M00075  N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    100512775 (ST6GAL2)
   00514 Other types of O-glycan biosynthesis
    100512775 (ST6GAL2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ssc01003]
    100512775 (ST6GAL2)
Enzymes [BR:ssc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.1  beta-galactoside alpha-(2,6)-sialyltransferase
     100512775 (ST6GAL2)
Glycosyltransferases [BR:ssc01003]
 Terminal extension
  Sialyltransferase
   100512775 (ST6GAL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_29
Motif
Other DBs
NCBI-GeneID: 100512775
NCBI-ProteinID: XP_003124903
Ensembl: ENSSSCG00000008141
UniProt: A0A480E8L5 A0A4X1VUQ1 F1SU24
Position
3
AA seq 503 aa AA seqDB search
MKPHLKQWRQGVLCGIFAWGLFFVVIFIYFTDSNPAEPAPSSFSFLETRRLLPVQGRQRA
IMGASEGLPESADARRGLLHGHPPGPLHSRPADPQTWAQDGLEDEGFFSPQKGRKSQSAF
PAEIAASDTSGPLSPAKLGWPERVRPEHQARGRRAKRRPRRQGRSVVPEEDGDRLYSPLS
RALLRRLWKGDASSRMLHPRLQKAMGAYLRANKHGVRFRGRRAAGRSRAELLCALRGRVR
VRTLDGTEPPFSALGWRTLVPAVPLGQLLPRGLRSCAVVTSAGAILNSSLGEEIDSHDAV
LRFNSAPTHGYEKDVGNKTTIRIINSQILTNPNHHFIDSSLYKDVILVAWDPAPYSANLN
LWYKKPDYNLFTPYVQHRQRNPNQPFYILHPKFIWQLWDIIQENTREKIQPNPPSSGFIG
VLLMMSLCSEVHVYEYVPSERQTELCHYHELYYDAACTLGAYHPLLYEKLLVQRLNTGAQ
GDLHRKGKVVLPGLRAVRCPPGA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccacacttgaagcaatggagacaaggggtgctgtgcgggatatttgcctggggg
ctcttcttcgtggtgattttcatctacttcaccgacagcaaccctgccgagcccgcgccc
agctccttctccttcctggagaccaggcgactcctgcccgtgcaggggaggcagagggcc
atcatgggtgcatcggagggcctacccgagagtgcggacgcacgcagggggctgctccat
ggacacccgcccggccccctgcactcgaggccggctgaccctcagacatgggcccaggac
gggttggaagatgaagggttcttttcgccccagaaagggagaaaatctcaaagcgctttc
cccgcggagattgccgcttcggacacgtcggggcccctctcccccgcaaagctgggctgg
cctgagagggttcggccggagcatcaggcccgtgggcggcgggcgaagcgccggccacgg
aggcaggggaggagcgtggtgcctgaggaggacggggaccggctgtactcgcccctgtcc
cgggccctgctgcgccggctctggaagggcgacgcgtcctcgaggatgctgcacccgcgc
ctgcagaaggccatgggcgcctaccttcgtgccaacaagcacggcgtgcgcttccggggg
cgccgggcggccgggcgcagccgggcggagctgctgtgcgcgctgcggggccgcgtgcgg
gtgcgcaccctggatggcaccgagccgcccttctcggcgctcggctggcgcacgctggtc
cccgccgtgccactcggccagttgctcccgcgcgggctccggagctgcgccgtggtcacg
tcagccggtgccatcctcaactcatccctaggcgaggagatagattcgcatgatgcagtt
ttgagatttaactctgctcctacacacggctacgagaaggatgtgggaaataaaaccacc
atccgcatcattaattcccagattctgaccaaccccaaccatcacttcattgacagttcg
ttgtataaagatgtcatcctagtggcgtgggacccagctccttattctgcaaaccttaac
ctgtggtacaagaagccggattacaacctgttcactccatatgttcagcatcgtcagcga
aacccaaaccagccattctacattctgcatcccaaatttatatggcagctctgggacatt
atccaggagaacacgcgggagaagatccagcccaacccgccatcctctggcttcatcggc
gtcctgctcatgatgagcctgtgcagcgaggtgcacgtctacgagtacgtcccgtcggag
cggcagaccgagctgtgccactaccatgagctgtactacgacgccgcctgcacgctgggc
gcctaccacccactgctctacgagaagctgctggtgcagcggctcaacacgggcgcgcag
ggcgacctgcaccgcaagggcaaggtggtgctgcccgggctgcgggctgtgcgctgcccg
ccgggtgcctga

DBGET integrated database retrieval system