KEGG   Sus scrofa (pig): 100513376Help
Entry
100513376         CDS       T01009                                 

Gene name
GMPPB
Definition
(RefSeq) mannose-1-phosphate guanyltransferase beta
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00051  Fructose and mannose metabolism
ssc00520  Amino sugar and nucleotide sugar metabolism
ssc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    100513376 (GMPPB)
   00520 Amino sugar and nucleotide sugar metabolism
    100513376 (GMPPB)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     100513376 (GMPPB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NTP_transferase Hexapep NTP_transf_3 Hexapep_2 IspD DUF3137 CTP_transf_3
Motif
Other DBs
NCBI-GeneID: 100513376
NCBI-ProteinID: NP_001231470
Ensembl: ENSSSCG00000011389
UniProt: A0A4X1SQL6
Position
13
AA seq 360 aa AA seqDB search
MKALILVGGYGTRLRPLTLSIPKPLVDFCNKPILLHQVEALASAGVDHVILAVSYMSQML
EKEMKAQEQRLGIRISMSHEEEPLGTAGPLALARDLLSETAEPFFVLNSDVICDFPFQAM
VQFHRHHGQEGSILVTKVEEPSKYGVVVCEADTGRIHRFVEKPQVFVSNKINAGMYILSP
AVLQRIQLQPTSIEKEIFPVMAKEGQLYAMELQGFWMDIGQPKDFLTGMCLFLQSLRQKQ
PEQLCSGPGIVGNVLVDPSARIGKNCSIGPNVSLGPGVVVEDGVCIRRCTVLRDAHIRSH
SWLESCIVGWRCRVGQWVRMENVTVLGEDVIVNDELYLNGASVLPHKSIGESVPEPRIIM
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcactgatcctggtgggtggctacgggacgcgcctgcggccgctgacgctaagc
ataccgaagccgctggtggatttctgcaataagcccattttgctgcatcaagtggaggcg
ctggcctcggcaggcgtggatcacgtgattctggccgtgagctatatgtctcagatgttg
gagaaggaaatgaaagcacaggagcaaaggctaggaatccgaatctccatgtcccatgaa
gaggagcctttgggaacagctggacccctggcactggcccgtgacctgctctctgagact
gcggagcctttttttgttctgaacagtgatgtgatctgcgattttcccttccaagccatg
gtgcagttccaccgccaccatggccaagagggctccattctggtgaccaaagtggaggag
ccctctaagtatggtgtggtggtgtgtgaggctgatacaggccgtattcaccggttcgtg
gagaagccacaggtgtttgtgtccaacaagatcaatgcaggcatgtacatcctgagccct
gcagtgctgcagcgcatccagctgcagcccacgtccattgagaaggagatcttcccggtc
atggccaaggaggggcagctctatgccatggagttgcagggcttctggatggacattggg
cagcccaaggatttcctcacaggcatgtgcctcttcctgcaatcattgcgacagaagcaa
cctgagcaactgtgctcaggtcctggcattgtgggcaacgtgctagtggacccaagtgcc
cgcattggcaagaactgcagcattggccccaatgtgagcctgggtcctggtgtagtggtg
gaggatggcgtgtgtatccggcggtgcacagtgctgcgagatgcccacatccgctcccac
tcctggcttgagtcctgcattgtaggctggcgctgccgagtgggccaatgggtgcgcatg
gagaatgtgacagtgctgggcgaggacgtcatagttaatgatgagctctaccttaacggg
gccagtgtgctgccccacaaatctattggtgagtcggttccggagcctcgaatcatcatg
tga

DBGET integrated database retrieval system