KEGG   Sus scrofa (pig): 100513441Help
Entry
100513441         CDS       T01009                                 

Gene name
ATF2
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-2 isoform X1
  KO
K04450  cyclic AMP-dependent transcription factor ATF-2
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04010  MAPK signaling pathway
ssc04022  cGMP-PKG signaling pathway
ssc04151  PI3K-Akt signaling pathway
ssc04211  Longevity regulating pathway
ssc04261  Adrenergic signaling in cardiomyocytes
ssc04668  TNF signaling pathway
ssc04714  Thermogenesis
ssc04728  Dopaminergic synapse
ssc04911  Insulin secretion
ssc04915  Estrogen signaling pathway
ssc04918  Thyroid hormone synthesis
ssc04922  Glucagon signaling pathway
ssc04925  Aldosterone synthesis and secretion
ssc04926  Relaxin signaling pathway
ssc04927  Cortisol synthesis and secretion
ssc04928  Parathyroid hormone synthesis, secretion and action
ssc04934  Cushing syndrome
ssc05030  Cocaine addiction
ssc05031  Amphetamine addiction
ssc05034  Alcoholism
ssc05161  Hepatitis B
ssc05163  Human cytomegalovirus infection
ssc05166  Human T-cell leukemia virus 1 infection
ssc05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100513441 (ATF2)
   04668 TNF signaling pathway
    100513441 (ATF2)
   04022 cGMP-PKG signaling pathway
    100513441 (ATF2)
   04151 PI3K-Akt signaling pathway
    100513441 (ATF2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100513441 (ATF2)
   04922 Glucagon signaling pathway
    100513441 (ATF2)
   04915 Estrogen signaling pathway
    100513441 (ATF2)
   04926 Relaxin signaling pathway
    100513441 (ATF2)
   04918 Thyroid hormone synthesis
    100513441 (ATF2)
   04928 Parathyroid hormone synthesis, secretion and action
    100513441 (ATF2)
   04925 Aldosterone synthesis and secretion
    100513441 (ATF2)
   04927 Cortisol synthesis and secretion
    100513441 (ATF2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100513441 (ATF2)
  09156 Nervous system
   04728 Dopaminergic synapse
    100513441 (ATF2)
  09149 Aging
   04211 Longevity regulating pathway
    100513441 (ATF2)
  09159 Environmental adaptation
   04714 Thermogenesis
    100513441 (ATF2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100513441 (ATF2)
  09165 Substance dependence
   05030 Cocaine addiction
    100513441 (ATF2)
   05031 Amphetamine addiction
    100513441 (ATF2)
   05034 Alcoholism
    100513441 (ATF2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100513441 (ATF2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100513441 (ATF2)
   05161 Hepatitis B
    100513441 (ATF2)
   05163 Human cytomegalovirus infection
    100513441 (ATF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ssc03000]
    100513441 (ATF2)
Transcription factors [BR:ssc03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    100513441 (ATF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf zf-C2H2 Herpes_UL16
Motif
Other DBs
NCBI-GeneID: 100513441
NCBI-ProteinID: XP_020931584
Ensembl: ENSSSCG00000015972
Position
15
AA seq 505 aa AA seqDB search
MKFKLHVNSARQYKDLWNMSDDKPFLCTAPGCGQRFTNEDHLAVHKHKHEMTLKFGPARN
DSVIVADQTPTPTRFLKNCEEVGLFNELASPFENEFKKASEDDIKKMPLDLSPLATPIIR
SKIEEPSVVETTHQDSPLPHPESTTSDDKEVPLAQTAQPTSAIVRPASLQVPNVLLTSSD
SSVIIQQAVPSPTSSTVITQAPSSNRPIVPVPGPFPLLLHLPNGQTMPVAIPASITSSNV
HVPTAVPLVRPVTMVPSVPGIPGPSSPQPVQSEAKMRLKAALTQQHPPVTNGDTVKGHSS
GLVRTQSEESRPQSLQQPATSTTETPASPAHTTPQTQSTTGRRRRAANEDPDEKRRKFLE
RNRAAASRCRQKRKVWVQSLEKKAEDLSSLNGQLQSEVTLLRNEVAQLKQLLLAHKDCPV
TAMQKKSGYHTTDKDDSSEDLSVPSSPHTEAIQHSSVSTSNGVSSTSKAEAVATSVLTQM
ADQSTEPALSQIVMAPSSQSQPSGS
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcaagttacatgtgaattctgccaggcaatacaaggacctgtggaatatgagt
gatgacaaaccctttctatgtactgcccctggatgtggccagcgttttaccaacgaggat
catttggctgtccataaacataaacatgagatgacactgaaatttggtccagcacgtaat
gacagtgtcattgtggctgatcagaccccaacaccaacacgattcttgaaaaactgtgaa
gaagtgggtttgtttaatgagttggcaagtccatttgagaatgaattcaagaaggcctca
gaagacgacattaaaaaaatgcctctagatttatctcctcttgcaacacccatcataaga
agcaaaattgaggagccctctgttgtagaaacaactcaccaagatagtcctttacctcat
ccagagtctactaccagcgatgataaggaagtacctttggcacaaactgcacaacccaca
tcagctattgttcgtccagcatcattacaggttcccaatgtgctgcttacaagttctgac
tcaagcgtaattattcagcaggcagtaccttcaccaacctcaagtactgtcatcacccag
gcaccatcttccaacaggccaattgttcctgtaccaggcccatttcctcttctgttacat
cttcctaatggacaaaccatgcctgttgctattcctgcatcaattacaagttctaatgtg
catgttccaactgcagtcccacttgttcgaccagtcaccatggtgcctagtgttccagga
attccaggtccttcctctcctcagccagtacagtcagaagcaaaaatgagattaaaagct
gctttgacccagcaacatcctccagttaccaatggtgataccgtcaaaggtcatagtagt
ggattggttaggactcagtcagaggaatctcgtccacagtcattacaacagcccgccaca
tctactacagaaactccggcttctccagctcatacaactccacagacccaaagtacaact
ggtcgtcgaagaagagcagctaatgaagatcctgatgaaaaaaggaggaaatttctggag
cgaaatagagcagcagcttcaagatgccgacagaaaaggaaagtctgggttcagtcttta
gagaagaaagcagaagacttgagttcattaaatggtcagctgcagagtgaagtcaccctg
ctgagaaatgaagtggcacagctgaaacagcttcttctggctcataaagattgccctgta
accgccatgcagaagaaatctggctatcatactactgacaaagatgatagttcagaagac
ctgtcagtgccgagtagtccacatactgaagctatacagcatagctctgtcagcacatcc
aacggagtcagctccacttccaaggcagaagctgtagccacttcagtcctcacccagatg
gcggaccagagtacagagcctgcgctttcacagattgttatggctccttcctcccagtca
cagccctcaggaagttga

DBGET integrated database retrieval system