KEGG   Sus scrofa (pig): 100513670Help
Entry
100513670         CDS       T01009                                 

Gene name
NCAPG
Definition
(RefSeq) condensin complex subunit 3
  KO
K06678  condensin complex subunit 3
Organism
ssc  Sus scrofa (pig)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ssc03036]
    100513670 (NCAPG)
Chromosome and associated proteins [BR:ssc03036]
 Eukaryotic type
  Chromosome condensation proteins
   Condensin I
    100513670 (NCAPG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cnd3 HEAT_2 HEAT Cnd1 HEAT_EZ Serine_rich UVR
Motif
Other DBs
NCBI-GeneID: 100513670
NCBI-ProteinID: XP_005666605
Ensembl: ENSSSCG00000008747
UniProt: F1S5C5 A0A4X1VBG3
Position
8
AA seq 1013 aa AA seqDB search
MGAEKRLLPIKEAFQLAQQPHQNQAKLVVALSRTYGSMDDKTDFHQEFVHYLKYAMVVYK
REPAVERIIEFAAKFVTSFHQSDMEDDEEEEDGGILNYLFTFLLKSHEANSNAVRFRVCQ
LINKLLGSMPENAQIDDDLFDKINEAMLVRLKDKIPNVRIQAVLALSRLQDPKDDECPVV
NAYATLIENDSNPEVRRAVLSCIAPSAKTLPKIVGRTKDVKEAVRKLAYQVLAEKVHMRA
LSIAQRVMLLQQGLNDRSDAVKQATQKHLLQGWLRFTEGNMLELLHRLDVENSSEVAVSV
LNALFSVTPLNELAEVCKNNDGRKLIPVETLTPEIALYWRVLCEYLKSKGDEGEEVLEQI
LPEPVVYAEYLLSYIQSIPVVNDEQRGDFSYIGNLMTKEFIGQQLILIIKSLDTNEEGGR
KRLLAILQEILTVPTTPVSLISFLVERLLHIMTDDNKRTQIVSEIISEIRAPIVTVGVNS
DPADARKKELKIAEIKVKLIEAKEALENCITLQDFNQASKLKEEIKALEDAKITLLKETE
QLEMKEVHVEKNDAETLQKCLVLCYELLKQMSISTGIGATMNGIIESLILPGIISVHPIV
RNLAVLCLGCCGLQNQDFASKHFVLLLQVLQIDDVTIKISALKAIFDQLMTFGFEPFKTK
KIKSLQSEGEEINTDEEQESKESEEEAATAKNVLKLLSDFLDSEVSELRTGAAEGLAKLM
FSGLLVSSRILSRLVLLWYNPVTEEDVRLRHCLGVFFPLFAYASRNNQECFEEAFLPTLQ
TLANAPGSSPLAEIDITNVAELLVDLTRPSGLNPKAKDSQDYQALTVHDNLAIKICNEIL
SCPCSPEVRVYTKALSSLELSSDLANKDLLVLLNEILEQVKDRTCLRALEKIKIQLEKGN
KENGDQAVAAQDDGTVTTLFQSEEKNKEVYITPVKDVKVTRMKSTQKQTNRGRRTVTASA
RMSRRRQTEAETDSESDHEVPEPESEMKMRLPRRAKTAALEKSKLSLAQFLNE
NT seq 3042 nt NT seq  +upstreamnt  +downstreamnt
atgggggcggagaagaggctgctgccgattaaggaggctttccagctggcgcagcagccg
caccagaaccaggcgaagctggtggtggcgctgagccgcacctatggctcgatggatgac
aaaacagattttcatcaggagtttgttcattaccttaaatatgcaatggtagtctataaa
cgagaaccagctgtggagaggataatagaatttgcagcaaagtttgttacttcatttcac
caatcagatatggaagatgatgaggaagaggaagatggtggcattttaaattatttgttt
acttttctattaaagtctcatgaagcaaacagcaatgcagttagatttagagtgtgccag
ctcataaataagctcttgggaagtatgccagaaaatgcccagattgatgatgatttgttt
gataaaattaatgaagccatgctggttagattgaaagataaaattccaaatgtaagaata
caggcagttcttgcactttcacgccttcaggatcccaaagatgatgaatgccctgtagtt
aatgcgtatgctactttgattgaaaatgattcaaatccagaggttaggcgggcagtgtta
tcatgtattgcaccatcagcaaagactttgccaaaaattgtgggccgcaccaaagatgtg
aaagaggctgtcagaaaactggcttatcaggttttagctgaaaaggttcacatgagagct
ttgtccattgctcagagggtaatgctccttcaacaaggtcttaatgacagatcagatgct
gtgaaacaagcaacacagaagcatcttctccaaggctggttacgtttcactgaaggaaat
atgcttgagttgcttcatcggttggatgtggagaattcttctgaagtggcagtctctgtt
ctcaatgccttattttcagtgactcctcttaatgaactagcagaagtctgtaaaaataat
gatggcaggaaattgattccagtggaaacattaactcctgaaattgctttgtattggcgt
gtcctttgtgaatatttgaaatcaaaaggagatgaaggtgaagaagttttagagcagatt
ttgccagagcctgtagtatatgcagagtacttactgagttatattcagagcattccagtt
gttaatgatgaacagagaggtgatttttcctatattggcaatttgatgacgaaagaattc
ataggtcaacaattgattctaattatcaagtctttggataccaatgaagaaggaggaagg
aaacgactgctggctattttacaggagattcttactgtccccactaccccagtatcccta
atttcttttcttgttgagagactacttcacatcatgacagatgataataagagaacacag
attgtttcagaaattatctcagagattcgggcacccattgtcactgttggtgttaatagt
gatccagctgatgcaagaaagaaagaactcaagatcgctgaaataaaagttaaacttatt
gaggcaaaagaagctttggaaaattgcattaccttgcaggattttaatcaagcatcgaaa
ttaaaagaagaaataaaagcattagaagatgccaaaataaccctattgaaagagacagag
caacttgaaatgaaagaagtccatgtagaaaagaatgatgccgaaacactgcagaagtgt
cttgttttgtgttatgaactcttgaagcagatgtccatatcaacaggtataggtgcaact
atgaatggcatcattgaatctttgattcttcctggaataataagtgttcatcctatagta
agaaatctggctgttttgtgcttgggatgctgcggactgcagaatcaggattttgcaagt
aaacactttgtattactactgcaggttttgcaaattgatgatgtgacaataaaaataagt
gctttaaaggcaatctttgaccagctgatgacatttggatttgaaccatttaaaactaaa
aaaatcaaatcccttcaaagtgaaggtgaagaaataaacactgatgaagagcaagagtca
aaagaatctgaagaagaggctgctacagccaagaatgttctgaaactactatccgatttc
ctagatagtgaggtgtctgaactcaggacaggagctgcagaaggactggccaagctgatg
ttctctgggctcttggtcagcagcaggattctttcccggcttgtcttgttgtggtataat
cctgtgactgaagaggatgttcgacttcgacattgccttggcgtgttctttcccctcttt
gcttatgcaagcaggaataaccaggaatgttttgaagaagcctttcttccaactctacaa
acactggccaatgcccctggctcttctcctttagctgaaatagatatcactaatgttgcc
gagttacttgtagatttgacgagaccaagtggattaaatcctaaagccaaggattcccaa
gattatcaggccttaacagttcatgacaatctggctataaaaatttgcaatgagatcctg
tcatgtccatgttcaccagaagttcgggtctatactaaagccttgagttcgttagagctc
agtagtgatcttgctaataaagatcttctggttctgttgaatgagattctagagcaagta
aaagacagaacgtgcctgagagctttggagaaaatcaagattcagctggaaaaaggaaat
aaagaaaatggtgaccaagctgtagcagcgcaggatgacggcacagtcacgactcttttt
caaagtgaagaaaagaataaagaagtgtatataactcctgtcaaagatgtaaaggtaacc
cgaatgaaatccactcagaagcagactaacagaggacgaagaacagtgacagcttcagct
agaatgagcaggagacgtcagactgaggctgagactgactctgaaagtgatcatgaagtt
ccagagccagaatcagaaatgaagatgagattaccaagacgagccaaaacagcagcacta
gaaaaaagtaaacttagccttgcacaatttctcaatgaatag

DBGET integrated database retrieval system