KEGG   Sus scrofa (pig): 100513720Help
Entry
100513720         CDS       T01009                                 

Gene name
GUK1
Definition
(RefSeq) guanylate kinase isoform X1
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00230  Purine metabolism
ssc01100  Metabolic pathways
Module
ssc_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    100513720 (GUK1)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     100513720 (GUK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_18 AAA_16 MMR_HSR1 RsgA_GTPase ABC_tran AAA_22 NACHT cobW AAA_30 AAA_29 AAA_14 NTPase_1 Zeta_toxin AAA_28 RNA_helicase AAA AAA_24 TsaE ATPase_2 AAA_5 Viral_helicase1 AAA_17 NB-ARC Rad17 DUF2075 T2SSE KAP_NTPase Dynamin_N
Motif
Other DBs
NCBI-GeneID: 100513720
NCBI-ProteinID: XP_003123661
Ensembl: ENSSSCG00000013990
UniProt: F1S5R9
Position
2
AA seq 219 aa AA seqDB search
MLRRPLAGLAAAALGRATSDGMSGPRPVVLSGPSGAGKSTLLKKLLQEHSSIFGFSVSHT
TRDPRPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKAAVRAVQAMNRICV
LDVDLQGVRNIKKTDLQPIYIFVQPPSLDVLEQRLRQRNTETEESLAKRLAAAKADMESS
KEPGLFDLIIINDSLDKAYWALKEALSEEIKKAQATGHS
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgctgcggcgcccgctggccgggctggcggctgcagccctgggccgggccacctcggac
gggatgtcaggaccaagacctgttgtcctgagcggaccctcaggggctgggaagagcacc
ctgctgaagaaactccttcaggaacatagcagcatcttcggcttcagcgtgtcccacact
acaagagatccgagaccaggagaagagaacggcaaagactactactttgtgaccagggag
gtgatgcagcgggacattgctgctggagacttcatcgagcatgctgagttctcagggaac
ttgtatgggaccagcaaagcagctgtgcgggccgtgcaggccatgaaccgcatctgtgtg
ctggatgtggacctgcagggtgtgcgcaacatcaagaagactgacctgcagcccatctac
atcttcgtgcagccaccctcactggatgtcctggagcagcggttgcggcagcggaacaca
gagacagaggagagcctggctaagcgtctggctgccgccaaggctgacatggaaagtagc
aaggagcccggcttgtttgacctgatcatcatcaacgacagtctggacaaggcctactgg
gccctgaaggaggcgctctctgaggaaataaagaaggctcaagcaacgggtcactcctga

DBGET integrated database retrieval system