KEGG   Sus scrofa (pig): 100514063Help
Entry
100514063         CDS       T01009                                 

Gene name
UGT2B31
Definition
(RefSeq) UDP-glucuronosyltransferase 2B31 precursor
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00040  Pentose and glucuronate interconversions
ssc00053  Ascorbate and aldarate metabolism
ssc00140  Steroid hormone biosynthesis
ssc00830  Retinol metabolism
ssc00860  Porphyrin and chlorophyll metabolism
ssc00980  Metabolism of xenobiotics by cytochrome P450
ssc00982  Drug metabolism - cytochrome P450
ssc00983  Drug metabolism - other enzymes
ssc01100  Metabolic pathways
ssc05204  Chemical carcinogenesis
Module
ssc_M00014  Glucuronate pathway (uronate pathway)
ssc_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100514063 (UGT2B31)
   00053 Ascorbate and aldarate metabolism
    100514063 (UGT2B31)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100514063 (UGT2B31)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100514063 (UGT2B31)
   00860 Porphyrin and chlorophyll metabolism
    100514063 (UGT2B31)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100514063 (UGT2B31)
   00982 Drug metabolism - cytochrome P450
    100514063 (UGT2B31)
   00983 Drug metabolism - other enzymes
    100514063 (UGT2B31)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100514063 (UGT2B31)
Enzymes [BR:ssc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     100514063 (UGT2B31)
Glycosyltransferases [BR:ssc01003]
 Others
  Hydrophobic molecule
   100514063 (UGT2B31)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C
Motif
Other DBs
NCBI-GeneID: 100514063
NCBI-ProteinID: NP_001231053
Ensembl: ENSSSCG00000025786 ENSSSCG00000030074
UniProt: F1RUR0
Position
8
AA seq 529 aa AA seqDB search
MSLKWLSLLLLLQLTCYFSSGRCGKVLVWPMEYSHWINMKIILEELVTRGHEVTVLKSSA
AILVDPNKSPTIKFESFPASVSQEDYENFFQQLLTEWIQGAKHSFWTKITTAQNIFSELS
DVSLKICKDAVLNKKLMTKLQESRFDVILADPIIPCAELVAEILNIPLVYSLRISPGYSI
EKFSGKLPFPPSYVPVVMSEFNDHMTFTERVNNMLYVVFLDFWFQTFNEKKWNQFYSEAL
GRPTTIFETMGKADMWLIRNYWDFEFPRPLLPNFEFIGGFHCKPAKPLPKEMEEFVQSAG
EHGIVLFTLGSMIRNMTEERANTIASAFAQIPQKVLWKYEGKKPDTLGPNTRLYKWIPQN
DLLGHPQTKAFITHGGANGVYEAIYHGIPMVGLPLFGDQPDNIAHMTAKGAAVRLDLDTM
SRTDLVNALKQVINNPFYKENVMRLSTIQHDQPVKPLDRAVFWIEFVMRHKGAKHLRPAA
HDLTWYQYHSLDVIGFLLACVATAAFALTRGCLFCCRKLANARKKAKRQ
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgtcactgaaatggctctcacttctgctgctgctacagctgacttgctactttagctct
ggcaggtgtggaaaggtgctggtgtggccaatggaatatagtcactggattaatatgaag
ataattctggaggaacttgtcaccaggggtcatgaggtgactgttctaaaatcatcagct
gccattcttgttgatcccaacaaatcacctactatcaaatttgagagtttccctgcatct
gtaagtcaagaggattatgagaatttcttccagcagcttctcactgaatggatacagggg
gcaaaacattcattttggacaaaaattacaacagcgcaaaatatattttcagaactttct
gatgtttcactgaagatctgtaaagatgctgtcttgaacaagaaacttatgacaaagcta
caagaatcaaggtttgatgtcatccttgcagatcccatcataccctgtgctgagctggtg
gctgagatactcaacatacctctggtatacagcctacgcatctctcctggttattcaatt
gaaaaattcagtggaaagcttccattcccaccatcctatgtacctgttgttatgtcagaa
tttaatgatcacatgacattcacggagagggttaataatatgttatatgtagtttttttg
gacttctggttccagacgtttaatgagaagaagtggaatcaattttacagcgaagcacta
ggaaggcccaccacaatatttgagacaatggggaaagctgacatgtggctcattcgaaac
tattgggattttgaatttcctcgcccactgctaccaaattttgaatttattggaggcttc
cattgcaaacctgcaaaacccctacctaaggaaatggaagagtttgtccagagtgctgga
gaacatggtattgtgctctttactctggggtcaatgatcaggaacatgacagaagaaaga
gccaatacaattgcatcagcctttgcccagattccccaaaaggttctgtggaaatacgaa
ggcaagaaacctgataccttaggacccaatactcggctgtataagtggatcccccaaaat
gaccttcttggtcatccccaaaccaaagctttcataactcatggtggcgccaatggcgtt
tatgaggccatctaccatgggattcctatggtgggcctgcctttgtttggtgatcagcct
gataacatcgctcacatgacagccaagggagcagctgtaagattggacttggacacaatg
tcaagaacagatctggtcaatgccttgaagcaagtcattaacaaccctttctacaaagaa
aacgtgatgaggttatcaaccattcaacatgatcagcctgtaaagcccctggaccgggcg
gtcttctggatcgagtttgtcatgcgccacaaaggagccaagcacctgcggccagcagcc
cacgacctcacctggtaccagtaccactctctggatgtcattgggttcctgctggcctgt
gtggcaacggctgcatttgccctcacaaggggttgtctgttttgttgccggaagttggct
aatgcaagaaagaaagcaaaaaggcagtag

DBGET integrated database retrieval system