KEGG   Sus scrofa (pig): 100514221
Entry
100514221         CDS       T01009                                 

Gene name
TELO2
Definition
(RefSeq) telomere length regulation protein TEL2 homolog isoform X1
  KO
K11137  telomere length regulation protein
Organism
ssc  Sus scrofa (pig)
Pathway
ssc03460  Fanconi anemia pathway
ssc04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    100514221 (TELO2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    100514221 (TELO2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ssc03032]
    100514221 (TELO2)
   03400 DNA repair and recombination proteins [BR:ssc03400]
    100514221 (TELO2)
DNA replication proteins [BR:ssc03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     100514221 (TELO2)
DNA repair and recombination proteins [BR:ssc03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    Other FA pathway factors
     100514221 (TELO2)
  Check point factors
   Triple T complex
    100514221 (TELO2)
SSDB
Motif
Pfam: Telomere_reg-2
Other DBs
NCBI-GeneID: 100514221
NCBI-ProteinID: XP_003124766
Ensembl: ENSSSCG00000008022
UniProt: A0A287AD90
Position
3
AA seq 952 aa
MNASQVSPPPPFWAEMVPPREVSPHCPPRPPEDVLPRRKVPNLRCAFRQPRAQVAIKPLK
RGQCDQGTDPVAPGYRAERRSTCPRTYTPHPTVAEVPAVATASLQRLRPRGEQGPASGRA
ARLHPRSGMDPVLSAVRLSVQEAVHVLSSSEDGGHIFSTLGSLKHYLGETENPALPEEQQ
EFARIHFPTVLRCLVRRLSPGWLELLPDGQLEQLWASFFLTGPADQAFLVLMEAIEDAAG
SSFRLMKMARLLARFLSVGRMAAVLEGQCRQQAEPAFPLLQATLLAKVVSLPDHLGNRLQ
QENLAEFLPQNYFLLLGKEVLRVLQGVVDSLRGGSDCSVSFLSQVLGKACILGRQKEILG
ALVPRLMALTQGHCLWQRVCWRLVERVPDRAMEAVLTGLVEAAPGPRVLSRLLGNLVTKS
KKAQFVMTRKLLLLRFSCTTPVLQSLLGYLAEDSQRRPLLMQALKELLETWGSSSAIRHT
PLAQQSYISKATLICLAHLQEAELRDCRAELLASLMAGVKCRLDSSLPPVRRLGMIVAEV
ASARIHPEGPPLRFQYEEDDLTREMLALATPWPVTDSPSAEGPPVAPVRGEDPDKKTAAS
GGPQAQPEGSDSELDSDDEFVPYDMSGDTELKSGKAPVYVRDCVEALTASEDWERWEAAL
RALEGLVFRSPAAAREVSVELAKVLLHLEEKTAVAGFEGLRQRALVAVTVTDPARVAEYL
TAQFYALNYSLRQRMDILDVLTLAAQELSRPGRLGRAQRSASGPSPQPSSTVAPTWRAVV
EERIRSKTRRFSKGSAGRGLAPVPNEFNAVAGYFFFPLIQRFDKPLVTFDLLGEDQLVLG
RLAHTLGALMYLAENTSVAVPMGKALLEFVWVLRFHGDGYMRRGLLSAVSAVLLSLPAER
LLADLPDELLETRSWLADVAEKDPDEDCRLLAVKALLLLEKLRDKLLALSSH
NT seq 2859 nt   +upstreamnt  +downstreamnt
atgaatgcgtcacaggtgtcccctccaccacctttctgggccgaaatggtacctcctcgc
gaggtctcgccacattgccccccaaggccgccagaggacgtcctgccaagacggaaggtt
ccaaatctgcgctgtgcattccggcagccacgagcacaggtggctatcaagcccttgaaa
cgcggacagtgcgaccaaggaactgacccggtggcccctggttaccgtgctgaacggcgc
agcacctgtcccaggacctacacaccgcatccaaccgtagccgaagtccccgcagttgcc
actgcttccctgcaaaggctgaggccgaggggagagcagggccctgcctccgggagagcg
gcaaggctacacccgcggtcggggatggatcccgtcctctctgccgtccggctctctgtc
caggaggctgttcacgtcctgtcgtcgtctgaggatggcggccacatcttctccaccctg
gggtcgctaaagcactatctcggtgaaacggagaacccagccctcccagaggagcagcag
gagtttgccaggatccactttcccaccgtcctcaggtgtcttgttcgccggctgagcccc
ggctggctggagctgctgcccgacgggcagctggagcagctgtgggccagcttcttcctg
acgggcccggcagaccaggctttcctggtgctgatggaggccatcgaggatgcggccggc
tccagcttccgtctgatgaagatggcgcggctgctggccaggttcctgagcgtgggcagg
atggccgctgtgttggaggggcagtgtcggcagcaggcagagccggccttccccctgctc
caggccacgctcctcgccaaggtggtgagcttgcccgatcacctgggcaaccgcctgcag
caggagaacctggccgagttcctcccgcagaactacttcctgctgctgggcaaggaggtc
ctgcgggtgctgcagggggtggtggactcgctccgaggtggctcggactgctctgtgtcc
ttcctgtctcaggtcctcgggaaggcctgcatcctcgggagacagaaggagatcctgggt
gcgctggtgccccgactgatggcgctcacccagggccactgcctgtggcagcgggtctgc
tggcgcctggtggagcgtgtgcccgaccgggccatggaggccgtgctgaccgggctggtg
gaggccgccccagggcctcgcgtcctctcgcggctgctggggaacctggtgaccaagagc
aagaaggcccagtttgtgatgacccggaagctgctgctcctccggttcagctgcacgaca
cctgtgctgcagagcctgctggggtacctggccgaggacagccagcgacgcccgctcctc
atgcaggcgctgaaggagctcctggagacatggggcagcagcagcgccatccgccacacg
cccctggcacagcagagctacatcagcaaggccaccctcatctgcctggcacacctgcag
gaggcggagctccgggactgccgggccgagttgctggccagcctgatggcgggagtgaag
tgccgcctggacagcagcctgccccccgtgcgccgcctgggcatgatcgtggctgaggtg
gccagcgcccggatccaccctgaggggcctcccctgaggttccagtatgaagaggacgac
ctgacccgcgagatgctggccctggccactccctggcccgtgactgacagtccctcggcg
gagggcccacctgtggctcccgtccgtggagaggaccctgacaagaagaccgcagccagt
ggcggcccccaggctcagccggagggctccgactccgagctggacagtgatgacgagttt
gtcccttacgacatgtcgggggacacggagctgaagagcggcaaggcacccgtgtacgtg
cgggattgcgtggaagctctgaccgcgtccgaggactgggagcgctgggaggcggctctg
cgggccctcgaggggctggtcttcaggagcccggctgccgcgcgggaggtgagcgtggag
ctggccaaggtgctgctgcacctggaggagaagacggccgtggcgggcttcgaggggctg
cgtcagagggccctggtggctgtcacagtcacagacccggcacgggtagccgagtacctg
actgcacagttctacgccctcaactacagcctccggcagcgcatggatatcctggacgtc
ctgactctggctgcccaggagctgtcgcggcctgggcgtctcgggagggcccagcggagt
gcctcgggccccagcccccagcccagcagcaccgtggctcccacctggcgggcagtggtg
gaggagcgcatccgaagcaagacccggcggttctccaagggctccgctgggcggggactg
gcccctgtccccaatgaattcaacgcggtggctggctacttctttttccccctcattcag
cgtttcgacaagcctctggtgacctttgacctgctgggagaggaccagctggttctcggg
aggctggcccacaccttaggggccctgatgtacctggctgagaacacctcggtggctgtg
cccatgggcaaggccctcctggagttcgtgtgggtccttcgtttccatggcgatgggtac
atgcgccggggcttgctgtctgccgtctccgccgtccttctcagccttccagctgagcgg
ctgctggcagacctgccggacgagctgctggagacccggtcctggctggcagatgtggct
gagaaggacccggacgaggactgcaggctgctggcggtgaaggcgctgctgcttctggag
aagctccgagacaagctgctggcactgtcctctcattag

DBGET integrated database retrieval system