KEGG   Sus scrofa (pig): 100514379Help
Entry
100514379         CDS       T01009                                 

Gene name
FBXO5
Definition
(RefSeq) F-box only protein 5 isoform X1
  KO
K10292  F-box protein 5
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04114  Oocyte meiosis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100514379 (FBXO5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ssc04121]
    100514379 (FBXO5)
   03036 Chromosome and associated proteins [BR:ssc03036]
    100514379 (FBXO5)
Ubiquitin system [BR:ssc04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     100514379 (FBXO5)
Chromosome and associated proteins [BR:ssc03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Early mitotic inhibitors
    100514379 (FBXO5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: F-box IBR F-box-like
Motif
Other DBs
NCBI-GeneID: 100514379
NCBI-ProteinID: XP_003121186
Ensembl: ENSSSCG00000004077
UniProt: F1S7X4
Position
1
AA seq 448 aa AA seqDB search
MSRRPCSCSPRPPSGSCRCSYSALTAAGRPRPSDDCKEEGSTLSVKMKCDFNYSHVHSGV
KPVKPDDSGRCSSYTPAYLEGSYNDCIKDYERLSDIRSPIVNSRIVELETESKPLHNKEN
QHVQQTLNSSNDIEELETSGPYEDSGYSSFSQQSVLNEHEDSSLTLVENYSDSPQPCLLR
IKSPDQYPNKNLLPALHFAKFVCSTLKKNCKRNPKIDREKLKEFVSSGNFRLQNIIGRKM
GLECVDILSELFRRGLRHLLANILTQLSDMDLINVSRVSTTWKKILEDDKGALQLYNKAI
QRITEKNIKFSPHASTREYVLFRTALASVQKSATQTLPKKDTQTKLPDPGDQKGSTFSRH
SEFSEVAKTLKKNESLKACIRCNSPAKYDCYLQRATCKREGCGFDYCTRCLCDYHTSEDC
SNSKPLKASYKMGPLPGTKKSKKNLRRL
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgagccggcgcccctgcagctgttccccacggccgccctccggttcctgccgctgcagc
tacagcgccctgacagctgccgggcgccctcgcccctcggacgattgtaaagaagaaggt
tccactctctccgtcaaaatgaagtgtgattttaactatagccatgttcattctggagtt
aaaccggtaaaacctgatgatagtggaagatgcagttcctacactcctgcatatttggaa
ggttcttataatgactgcattaaagactatgaaaggttatcagatattaggtctccaatc
gtgaactccaggatcgtagagcttgaaactgaaagcaagcccttgcataataaggaaaat
caacatgtgcaacaaacacttaatagttcaaatgacatagaagaactggagaccagtgga
ccttatgaagacagtggctactcttcattttcccaacaaagtgtcctcaatgaacatgaa
gacagtagtcttacattggtggaaaattatagtgacagtccacaaccttgcctgctacgg
ataaaaagcccagaccaatatcctaacaaaaacttgctgccagctcttcattttgcaaaa
tttgtttgttcaacattaaaaaaaaattgtaaacgaaatcctaaaatagatcgagagaaa
ctgaaggaatttgtatccagtggaaattttagactacagaatataattggcaggaaaatg
ggcctagaatgtgtagatattctcagcgaactctttcgaaggggactcaggcatctctta
gcaaatattttaacacagctcagtgatatggacttaatcaatgtgtctagagtgagcaca
acttggaagaagattctagaagatgataagggggcattgcaattatacaataaagcaata
caaagaattactgaaaagaacattaagttttcaccacatgcttcaaccagagaatatgtt
ttattcagaaccgcattagcatctgttcaaaaatcagcaacccagactctccctaaaaaa
gatactcaaaccaagttacctgatccaggtgatcagaaaggttctacctttagtcgacac
agtgaattctctgaggttgccaagactttgaaaaagaatgaaagcctcaaagcctgcatt
cgctgtaattcaccagcaaaatatgattgctatttgcaacgggcaacctgtaaacgagaa
ggctgtggatttgattattgtacaaggtgcctgtgtgattatcatacctctgaagactgt
tcaaatagcaagcctttaaaagccagttataaaatgggtcctctgccaggtactaagaaa
agcaagaagaatttacgacgattgtga

DBGET integrated database retrieval system