KEGG   Sus scrofa (pig): 100514510
Entry
100514510         CDS       T01009                                 

Gene name
TM7SF2
Definition
(RefSeq) delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00100  Steroid biosynthesis
ssc01100  Metabolic pathways
Module
ssc_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    100514510 (TM7SF2)
Enzymes [BR:ssc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     100514510 (TM7SF2)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT PEMT
Other DBs
NCBI-GeneID: 100514510
NCBI-ProteinID: XP_003122590
Ensembl: ENSSSCG00000013004
UniProt: A0A480QTI0
Position
2
AA seq 418 aa
MAPPQGPRAPLEFGGPLGAAALMLLLPATMFHLLLAARSGPARLLGPPPYLPGLEMLWSP
WALFLCLAWLGLQAALYLLPARKVAEGQELKDKRRLLYPINGFQALVLTALLVGLGVLAR
LPLGALPEMLLPLAFSATLIAFVGSLLLYLKALVAPASALAPGGNSGNPVYDFFLGRELN
PRICSFDFKYFCELRPGLIGWVLINLALLMQEAELRGSPSLAMWLVNGFQLLYVGDALWH
EEAVLTTMDIIHDGFGFMLAFGDLAWVPFTYSLQAQFLLYHPQPLGLPGASVICLINAVG
YYIFRGANSQKNTFRKNPSDPRVADLETIPTATGRQLLVSGWWGMVRHPNYLGDLIMALA
WSLPCGVSHLLPYFYLLYFTALLVHREARDEQQCLQKYGLAWHEYCRRVPYRIMPYVY
NT seq 1257 nt   +upstreamnt  +downstreamnt
atggcccctcctcagggcccccgggccccgctggaattcggaggacccctgggtgctgcg
gcgctgatgctgctgctccccgccaccatgttccacctgctactggcagcccgttcgggc
ccggcgcgtctcctgggcccacccccctacctgcccggactcgagatgctgtggagcccg
tgggcgctgtttctgtgtctcgcctggctcggcctgcaggcggcgctctacctcttgccg
gcgcgcaaggtggccgaggggcaggaactgaaggacaagagacgactgctctaccccatt
aacggcttccaggccctggtgctgacagccctattggtgggcctgggggtgttagccagg
ctgcccctgggcgcgctcccagaaatgctcctgcccttggcattttccgccaccctcatc
gccttcgtcggcagcctccttctctatctgaaggctctggtagcccctgcctccgccctg
gcacctggcgggaactcaggcaaccccgtttacgactttttcctgggacgggagctcaac
ccacgcatctgttcctttgacttcaaatatttctgcgaactgcggcctggcctcatcggc
tgggtcctcatcaacctggccttgctgatgcaggaggcagaacttcgcgggagtccctca
ctggccatgtggctggtcaatggcttccagctactatacgtgggagatgccctttggcac
gaggaggcggtcctcaccaccatggacatcatccacgatgggtttggcttcatgctggcc
ttcggggacctcgcctgggtccctttcacctacagcctgcaggcgcagttcctgctgtac
cacccacagcccctggggttgcccggggcctcggtcatctgcctcatcaacgctgttgga
tactacattttccgtggagccaattctcagaaaaacaccttccgaaagaatccttctgat
cccagagtggccgaccttgagaccatccctacagccacagggcgacagctgctggtgtcc
ggatggtggggtatggtccgccatcccaactaccttggagacctcatcatggctctggcc
tggtccctgccctgcggggtgtcccacctgttgccctacttctacctcctctacttcact
gcgctgctggtgcaccgggaggcccgcgatgagcagcagtgtctacagaagtatggcttg
gcctggcacgaatactgccggcgggtgccctaccgaatcatgccctatgtctactga

DBGET integrated database retrieval system