KEGG   Sus scrofa (pig): 100514573
Entry
100514573         CDS       T01009                                 

Gene name
BMP10
Definition
(RefSeq) bone morphogenetic protein 10
  KO
K22670  bone morphogenetic protein 10
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100514573 (BMP10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ssc04052]
    100514573 (BMP10)
Cytokines and growth factors [BR:ssc04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   100514573 (BMP10)
SSDB
Motif
Pfam: TGF_beta TGFb_propeptide
Other DBs
NCBI-GeneID: 100514573
NCBI-ProteinID: XP_003125118
Ensembl: ENSSSCG00000008345
UniProt: A0A287A7C6 A0A4X1W9X6
Position
3
AA seq 423 aa
MGFLALQLCALSCLVAPWVSGSPIMSLEQSPLEEDMPLFDDVFSEQDGVDFNSLLQSMKN
EFLKTLNLSDIPMQDSAKVDPPEYMLELYNKFATDRTSMPSANIIRSFKNEDLYSQPVSF
NGLRKYPLLFNVSIPHHEEVTMAELRLYTLVQRDRLMYEGVDRKITIFEVLESQGDHEGE
RSLLVLVSGEIYGTNSEWETFDVTDAIRRWQNSGSSTHQLEVHIESRQGMEDAGRGQLEI
DISARNKHEPLLVVFSDDQSSEKERKEELSEMIAHEQFPELDNLGLGGYSSGPGEEALLQ
MRSNIIYDSTARIRRNAKGNYCKRTPLYIDFKEIGWDSWIIAPPGYEAYECRGVCNYPLA
EHLTPTKHAIIQALVHLKNSQKASKACCVPTKLEPISILYLDKGVVTYKFKYEGMAVSEC
GCR
NT seq 1272 nt   +upstreamnt  +downstreamnt
atgggtttcctggccctacagctgtgcgcgctctcctgcctggtggctccctgggtttct
ggcagccccatcatgagcctggagcagtcgcctctggaagaagatatgccactctttgac
gatgtcttctcggagcaagatggtgtcgacttcaacagcctgctccagagcatgaagaac
gagtttctcaagacattgaacctgtctgacatcccgatgcaggactcagccaaggtcgac
ccccccgagtacatgctggaactctacaataaatttgccacagatcggacctccatgccc
tctgccaacatcattaggagtttcaagaatgaagatctgtattcccaacctgtcagtttt
aatgggctccgaaaataccctctcctcttcaatgtgtccatccctcaccatgaagaggtc
accatggctgaactcaggttgtacaccctggtgcaaagagatcgcctgatgtatgaaggc
gtggaccggaagattaccatttttgaagtactcgagagccaaggggaccatgagggtgaa
agaagcctgctggtcttggtgtcaggggagatctatggaaccaacagtgagtgggagact
tttgatgtcacggatgccatcaggcgttggcaaaattcagggtcatccacccaccagctg
gaggtgcacatcgagagcaggcagggaatggaggatgctggcaggggacaactggaaata
gacatcagtgcccggaataagcatgaacctttgcttgttgtgttttccgatgatcaaagc
agtgagaaggagcggaaggaggaactgagtgagatgatcgcccatgagcaatttccagaa
ctggacaacctgggtctgggtggttattccagcggacctggagaagaggctttgctacag
atgaggtcaaacatcatctacgactccacagcccgtatcagaaggaatgcaaagggcaac
tactgcaagaggaccccgctctacatcgacttcaaggagattggctgggactcttggatc
attgccccacccggctacgaagcctatgaatgccgtggtgtttgcaactaccccctggca
gaacatctcacccccacgaagcatgcaattatccaggccttggtccacctcaagaattcc
cagaaggcttccaaagcctgctgcgtgcccaccaagctggagcccatctccatcctctac
ttagacaaaggtgtcgtcacctacaagtttaaatatgaaggcatggccgtctctgaatgt
ggctgtagatag

DBGET integrated database retrieval system