KEGG   Sus scrofa (pig): 100514637
Entry
100514637         CDS       T01009                                 

Gene name
RPS27A
Definition
(RefSeq) ubiquitin-40S ribosomal protein S27a
  KO
K02977  ubiquitin-small subunit ribosomal protein S27Ae
Organism
ssc  Sus scrofa (pig)
Pathway
ssc03010  Ribosome
ssc04120  Ubiquitin mediated proteolysis
ssc04137  Mitophagy - animal
ssc05012  Parkinson disease
ssc05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    100514637 (RPS27A)
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100514637 (RPS27A)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    100514637 (RPS27A)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100514637 (RPS27A)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100514637 (RPS27A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ssc03011]
    100514637 (RPS27A)
   04121 Ubiquitin system [BR:ssc04121]
    100514637 (RPS27A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ssc04147]
    100514637 (RPS27A)
Ribosome [BR:ssc03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    100514637 (RPS27A)
  Archaea
    100514637 (RPS27A)
Ubiquitin system [BR:ssc04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitins
   100514637 (RPS27A)
Exosome [BR:ssc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100514637 (RPS27A)
  Exosomal proteins of colorectal cancer cells
   100514637 (RPS27A)
SSDB
Motif
Pfam: ubiquitin Ribosomal_S27 Rad60-SLD Ubiquitin_2 Rad60-SLD_2 TBK1_ULD DUF2407 Ubiquitin_5
Other DBs
NCBI-GeneID: 100514637
NCBI-ProteinID: XP_003125184
Ensembl: ENSSSCG00000022357
UniProt: A0A4X1WDC9
Position
3
AA seq 156 aa
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRE
CPSDECGAGVFMASHFDRHYCGKCCLTYCFNKPEDK
NT seq 471 nt   +upstreamnt  +downstreamnt
atgcagatattcgtgaagacgctgacgggcaagaccatcactctcgaggtcgaaccctcg
gatacaatagaaaatgtaaaggctaagatccaggataaggaagggattcctcctgaccag
caaagactgatctttgctggcaagcaactggaagatggacgtactttgtctgactacaac
attcaaaaggagtccactcttcatcttgtattgagacttcgtggtggtgctaagaaaagg
aagaagaagtcttacaccactcccaagaagaacaagcataagagaaagaaggttaagctg
gctgtcctaaaatactataaggtggatgagaacggcaaaatcagtcgtcttcgtcgggag
tgcccttcagatgaatgtggtgctggagtttttatggccagccactttgacagacattat
tgtggcaaatgttgcctgacctattgtttcaacaaaccagaagacaagtaa

DBGET integrated database retrieval system