KEGG   Sus scrofa (pig): 100514966
Entry
100514966         CDS       T01009                                 

Gene name
KCNAB2
Definition
(RefSeq) voltage-gated potassium channel subunit beta-2 isoform X4
  KO
K04883  potassium voltage-gated channel Shaker-related subfamily A, beta member 2
Organism
ssc  Sus scrofa (pig)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ssc04040]
    100514966 (KCNAB2)
Ion channels [BR:ssc04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   100514966 (KCNAB2)
SSDB
Motif
Pfam: Aldo_ket_red SMI1_KNR4
Other DBs
NCBI-GeneID: 100514966
NCBI-ProteinID: XP_005656049
Ensembl: ENSSSCG00000020749
UniProt: A0A286ZW35
Position
6
AA seq 353 aa
MYPESTTGSPARLSLRQTGSPGMIYRNLGKSGLRVSCLGLGTWVTFGGQITDEMAEQLMT
LAYDNGINLFDTAEVYAAGKAEVVLGNIIKKKGWRRSSLVITTKVFWGGKAETERGLSRK
HIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETVRAMTHVINQGMAMYWGTSRWSSME
IMEAYSVARQFNLIPPICEQAEYHMFQREKVEVQLPELFHKIGVGAMTWSPLACGIVSGK
YDSGIPPYSRASLKGYQWLKDKILSEEGRRQQAKLKELQAIAERLGCTLPQLAIAWCLRN
EGVSSVLLGASSADQLMENIGAIQVLPKLSSSTIHEIDSILGNKPYSKKDYRS
NT seq 1062 nt   +upstreamnt  +downstreamnt
atgtacccggaatcgaccacgggctccccggctcggctctccctgcggcagacgggctcc
cccggcatgatctacaggaacctgggcaagtccggcctgagggtctcctgcctggggctc
ggaacatgggtgaccttcggaggccagatcacggacgagatggcagagcagctaatgacc
ttggcctacgacaacggcatcaacctcttcgatactgcagaggtctacgctgcgggcaag
gctgaggtggttctaggaaacatcatcaagaagaagggatggaggcgatccagcctcgtc
atcaccaccaaagtcttctggggaggaaaagcggagaccgagaggggcctttcccggaag
cacatcatagaaggtctgaaagcctccctggagcggctgcagttggagtatgtggacgtg
gtgttcgccaaccgcccggaccccaacacgcccatggaagagacggtgcgcgccatgacc
cacgtcatcaaccaggggatggccatgtattggggcacgtcacgctggagctccatggag
atcatggaggcctactccgtggcccggcagttcaacctgatcccgcccatctgcgagcag
gccgagtaccacatgttccagcgcgagaaggtggaggtgcagctgccagagctcttccac
aaaataggagtgggcgccatgacctggtcccctctggcctgcggcatcgtttctggaaag
tatgacagtggcatcccgccctactcgagagcctccttgaagggctaccagtggctgaag
gacaagatcctgagtgaggagggccggcgccagcaggccaagctgaaggagctgcaggcc
atcgccgagcgcctgggctgcaccctcccgcagctggccatagcctggtgcctgaggaat
gagggggtcagctccgtgctcctgggtgcttccagcgcagaccagctgatggaaaacatt
ggagcaattcaggttcttccaaaactgtcgtcttccactatccacgagatcgatagtatt
ttgggcaataaaccctacagcaaaaaggactacagatcctaa

DBGET integrated database retrieval system