KEGG   Sus scrofa (pig): 100515237
Entry
100515237         CDS       T01009                                 

Gene name
RBM5
Definition
(RefSeq) RNA-binding protein 5
  KO
K13094  RNA-binding protein 5/10
Organism
ssc  Sus scrofa (pig)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ssc03041]
    100515237 (RBM5)
Spliceosome [BR:ssc03041]
 Complex A
  Other components
   Complex A specific factors
    100515237 (RBM5)
SSDB
Motif
Pfam: G-patch OCRE RRM_1 zf-RanBP G-patch_2 GSIII_N zf-C2H2
Other DBs
NCBI-GeneID: 100515237
NCBI-ProteinID: XP_005669645
Ensembl: ENSSSCG00000011395
UniProt: A0A480DPP4 A0A4X1SMW8
Position
13
AA seq 815 aa
MGSDKRVSRTERSGRYGSIIDRDDRDERESRSRRRDSDYKRSSDDRRGDRYDDYRDYDSP
ERERERRNSDRSEDGYHSDGDYGEHDYRHDISDERESKTIMLRGLPITITESDIREMMES
FEGPQPADVRLMKRKTGVSRGFAFVEFYHLQDATSWMEANQKKLVIQGKHIAMHYSNPRP
KFEDWLCNKCCLNNFRKRLKCFRCGADKFDSEQEVPPGTTESVQSVDYYCDTIILRNIAP
HTVVDSIMTALSPYASLAVNNIRLIKDKQTQQNRGFAFVQLSSAMDASQLLQILQSLHPP
LKIDGKTIGVDFAKSARKDLVLPDGNRVSAFSVASTAIAAAQWSSTQSQSGEGGSVDYSY
LQPGQDGYAQYAQYSQDYQQFYQQQAGGLESDASSASGTAVTTTSAAVVSQSPQLYNQTS
NTPGSPTEEAQPSTSTSTQAPAASPTGVVPGTKYAVPDTSTYQYDESSGYYYDPTTGLYY
DPNSQYYYNSLTQQYLYWDGEKETYVPAAESNSHQQTGLPPAKEGKEKKEKPKSKTAQQI
AKDMERWAKSLNKQKENFKNSFQPVNSLREEERRESAAADAGFALFEKKGALAERQQLIP
ELVRNGDEENPLKRGLVAAYSGDSDNEEELVERLESEEEKLADWKKMACLLCRRQFPNKD
ALVRHQQLSDLHKQNMDIYRRSRLSEQELEALELREREMKYRDRAAERREKYGIPEPPEP
KRKKQFDAGTVNYEQPTKDGIDHSNIGNKMLQAMGWREGSGLGRKCQGITAPIEAQVRLK
GAGLGAKGSAYGLTGADSYKDAVRKAMFARFTEME
NT seq 2448 nt   +upstreamnt  +downstreamnt
atgggttcagacaaacgagtgagtagaacagagcgcagtggaaggtatggttccatcata
gacagggatgaccgtgatgagcgtgaatccagaagcaggcggagggactcagattataaa
agatctagtgatgatcggaggggtgatcgatacgatgactaccgagactatgacagtcca
gagagagaacgtgaaagaaggaacagtgaccgatctgaagatggctaccattcagatggt
gactatggcgagcatgactataggcatgacatcagtgatgagagggagagcaagaccatc
atgcttcgcggccttcctatcaccatcacggagagcgatattcgagaaatgatggaatca
tttgaaggccctcagcctgcggacgtgaggctgatgaagaggaaaacaggtgtaagccgt
ggtttcgccttcgtggagttttatcacttgcaagatgctaccagctggatggaagccaat
cagaaaaagttggtgattcaaggaaagcatatcgcaatgcattatagcaatcccagacct
aagtttgaagattggctttgtaacaagtgctgccttaacaatttcaggaaaagactaaaa
tgcttccgatgtggagcagacaagtttgattctgaacaggaagtgccccctggaaccaca
gaatcagttcagtctgtggattactactgtgatacaatcatacttcgaaacatagctcca
cacactgtggtggattccatcatgacagcgctgtctccctacgcgtccttagctgtcaat
aacattcgcctcataaaagataaacagacccagcagaacagaggtttcgcgtttgtgcag
ctgtcttctgcaatggatgcttctcagctgcttcagatactacagagcctccatcctcct
ttgaaaattgatggcaaaactattggggttgattttgcaaaaagtgccagaaaagacttg
gtcctcccagatggtaaccgggtcagcgccttctctgtggctagtacagccattgctgcc
gctcagtggtcatccacccagtctcagagtggtgaaggaggcagtgttgactacagttac
ctgcaaccaggccaagatggctacgcccagtatgctcagtattcacaggattaccagcag
ttttatcagcaacaagctggaggattggaatctgatgcatcatctgcatcaggcacagca
gtgaccaccacctcagcagctgtagtgtctcagagtccccagctgtataaccaaacctcc
aatacacccggctctccgactgaggaagcacagcctagcactagcacaagtacacaggcc
ccagccgcttcccccactggtgtagttcctggtaccaaatatgcagtgcctgacacatcc
acttaccagtatgatgaatcttcaggatattattatgatccaaccacagggctgtattat
gaccccaactcacagtactactacaattccttaactcagcagtacctgtactgggatgga
gaaaaggagacctatgtgccggccgcggagtctaactcccaccagcagacgggcctccct
cctgcgaaagaggggaaggaaaagaaagagaaacccaagagcaaaacagcccagcagatt
gccaaagacatggaacgctgggctaagagtttaaacaagcagaaagaaaattttaaaaac
agctttcaacctgtcaattccttgagggaagaagaaaggagagaatctgctgcagcagat
gctgggtttgctctctttgagaagaagggagccttagcagaaaggcagcagctcatccct
gaattggtgcgaaatggagacgaggaaaatcccctcaaaaggggtctggttgctgcttat
agtggtgacagtgacaatgaagaggagctagtggagagacttgagagtgaggaagaaaag
ctggccgactggaagaagatggcctgcttgctctgccggcgccagttcccaaacaaagac
gccctggtcaggcaccagcagctctcagacctacacaagcaaaacatggacatctaccga
cgatccagattgagtgagcaggagctggaagccttggagctgagggagagagagatgaaa
taccgggatcgagctgcagaaagacgagagaagtatggcatcccagaacctccagaaccc
aagcgcaagaagcagtttgatgctggcactgtgaattacgagcagcccaccaaagatggc
attgaccacagtaacattggcaacaagatgctgcaggccatgggttggagggaaggctcg
ggtttgggaagaaagtgtcaaggcatcacagcccccattgaggctcaagtccggctaaaa
ggagctggcctaggagccaaaggcagcgcatatggactcactggtgcagattcctacaaa
gatgctgtacggaaggccatgtttgcccggttcactgagatggagtga

DBGET integrated database retrieval system