KEGG   Sus scrofa (pig): 100515411Help
Entry
100515411         CDS       T01009                                 

Gene name
ABHD6
Definition
(RefSeq) monoacylglycerol lipase ABHD6 isoform X1
  KO
K13700  abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04723  Retrograde endocannabinoid signaling
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    100515411 (ABHD6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ssc01002]
    100515411 (ABHD6)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     100515411 (ABHD6)
Peptidases [BR:ssc01002]
 Serine Peptidases
  Family S33
   100515411 (ABHD6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Ndr Lipase DUF1057 DLH Esterase Thioesterase
Motif
Other DBs
NCBI-GeneID: 100515411
NCBI-ProteinID: XP_003132321
Ensembl: ENSSSCG00000011470
UniProt: F1SGJ4
Position
13
AA seq 337 aa AA seqDB search
MDLDVVNMFVIAGGTLAIPILAFVASFLLWPSALIRIYYWYWRRALGMQVRYVHHEDYQF
CYSFRGRPGHKPSILMLHGFSAHKDMWLSVVKFLPKNLHLICVDMPGHEGTTRSSLDDLS
IDGQVKRIHQFVECLKLNRKPFHLIGTSMGGHVAGVYAAYYPSDLCSLSLVCPAGLQYST
DNHFVKQLKELQESAAIEKIPLIPSTPEEMSEMLQLCSYARIKVPQQILQGLVDVRIPHN
NFYRKLFLEMVSEKSRYCLHQNMDKIKVPTQIIWGKEDQILDVSGADMLAKSITNCHVDL
LENCGHSVVMERPRKTAKLVIDFLTSVHNTDNNKKLD
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggatcttgacgtggttaacatgtttgtgatcgcgggtgggacgctggccatcccgatc
ctggcatttgtagcctcatttctcctgtggccttcagcgctgataagaatctattactgg
tactggcggagggcgctgggcatgcaggtccgctatgttcaccacgaggactatcagttc
tgctactccttccgaggcaggcctgggcacaagccttccatcctcatgctccacggattc
tctgcgcacaaggacatgtggcttagcgtggtcaagttccttccaaagaacctgcacttg
atctgcgtggacatgccaggacatgagggcaccacccgttcctccctggatgacctgtcc
atagatgggcaagtcaagaggatacaccagtttgtagaatgcctcaagctgaacagaaaa
cccttccacctgataggcacttccatgggtggccacgtggctggggtgtatgccgcttac
tacccatcggatctctgcagcctgtctcttgtgtgccctgctggtctgcaatactcaact
gataatcactttgtaaagcagctgaaagaactgcaggagtccgctgccatagaaaagatt
cccttgatcccgtccacccccgaagagatgagtgaaatgctccagctctgctcctatgcc
cgtatcaaggtgccccagcagatcctgcaaggcctggtcgatgtccgcatccctcataac
aacttctaccgaaagctgtttttggaaatggtcagtgagaagtcaagatactgtctccat
cagaacatggacaagatcaaggtcccaacgcagatcatctgggggaaagaagatcagata
ctcgatgtatctggggcagacatgttggctaagtcaatcaccaactgccatgtggacctc
ctggaaaactgtgggcactcagtggtgatggagagacccaggaagacagccaagctcgtg
attgacttcttaacttccgtgcacaacacagacaacaacaagaagctggactaa

DBGET integrated database retrieval system