KEGG   Sus scrofa (pig): 100515445Help
Entry
100515445         CDS       T01009                                 

Gene name
FLT3
Definition
(RefSeq) receptor-type tyrosine-protein kinase FLT3 isoform X2
  KO
K05092  fms-related tyrosine kinase 3 [EC:2.7.10.1]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04010  MAPK signaling pathway
ssc04014  Ras signaling pathway
ssc04151  PI3K-Akt signaling pathway
ssc04640  Hematopoietic cell lineage
ssc05200  Pathways in cancer
ssc05202  Transcriptional misregulation in cancer
ssc05221  Acute myeloid leukemia
ssc05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100515445 (FLT3)
   04010 MAPK signaling pathway
    100515445 (FLT3)
   04151 PI3K-Akt signaling pathway
    100515445 (FLT3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100515445 (FLT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100515445 (FLT3)
   05202 Transcriptional misregulation in cancer
    100515445 (FLT3)
   05230 Central carbon metabolism in cancer
    100515445 (FLT3)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100515445 (FLT3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ssc01001]
    100515445 (FLT3)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ssc04090]
    100515445 (FLT3)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100515445 (FLT3)
Protein kinases [BR:ssc01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   100515445 (FLT3)
CD molecules [BR:ssc04090]
 Proteins
  100515445 (FLT3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase ig Ig_3 Ig_2 I-set APH
Motif
Other DBs
NCBI-GeneID: 100515445
NCBI-ProteinID: XP_005668350
Ensembl: ENSSSCG00000009314
Vega: OTTSUSG00000002344
UniProt: K7GKA2
Position
11
AA seq 971 aa AA seqDB search
MIFETITNQDLPVIQCILINHRNNDSSVGTTSSNPMASEAQEDLGCALRPKSKGTVYEAA
TVEVDVSASITLQVLVATPGNISCLWVFKNSSRNCQPHFDLQNRGVVSMVILKMTETQAG
EYQLFIQSEAVNYTVLFTVSIRNTLLYTLRRPYFRKMENQDALVCISEGIPEPTVEWVFC
DAQSDSCKGESPAVVTKEESVLHELFGTDIRCCARNELGRECTKLFTIDLNQTPQTTPPQ
LFLKVGEPLWIRCKAVHVNHGFGLSWELENKALEEGSCFEMSTYSTNRTMIRILFAFVSS
VGRNDTGYYTCSSSEHPSKSALVTILEKGFINASKSNEDYEIDQYEEFCFSVRFKAYPQI
RCTWTFSRKSFPCEQRGLDDGYSISKFCNHKHQPGQYIFHAENDDAQFTKMFTLNIRRKP
QVLAEASASQASCSSDGYPLPSWTWKKCSDKSPNCTEEITEGIWNKKANRKVFGQWISSS
TLNMSEAVKGFLVKCCAYNSLGTSCETILLNSPGPFPFIQDNISFYATIGLCLPFIAVLT
MLICHKYKKRFRYESQLQMVQVTGSLDNDYFYIDFREYEYDLKWEFPRENLEFGKVLGSG
AFGKVMNATAYGISKTGVSIQVAVKMLKEKADSSEREALMSELKMMTHLGSHENIVNLLG
ACTLSGPIYLIFEYCCYGDLLNYLRSKREKFHRTWTEIFKEHNFSFYPTFQSHPNSSMPG
SREVQIHPDSDPISGFNGNSFQSEDEIEYENQKRLEEEEDLNVLTFEDLLCFAYQVAKGM
EFLEFKSCVHRDLAARNVLVTHGKVVKIGDFGLARDIMSDSNYVIRGNARLPVKWMAPES
LFEGIYTIKSDVWSYGILLWEIFSLGVNPYPGIPADANFYKLIQSGFKMDQPFYATEEIY
FIMQSCWAFDSRKRPSFPNLTSFLGCQLADAEEAMYQNTDGRASERPLYQNRRPFSRQVD
SGPPSPQAEDS
NT seq 2916 nt NT seq  +upstreamnt  +downstreamnt
atgatctttgagactattacaaatcaagacctgcctgtgatccagtgcattttaatcaac
cataggaacaatgattcatcggtggggaccacgtcatcgaatcctatggcgtcagaagcc
caggaagacctgggttgtgccttgaggcccaagagcaaggggacagtctacgaagcagcc
actgtggaggtggacgtgtccgcgtccatcacgctgcaggtgctggtcgccaccccaggg
aacatttcctgcctctgggtctttaaaaatagctcccggaattgccagccacacttcgac
ttgcaaaacagaggagttgtttccatggtcattttgaaaatgacagaaacccaggctgga
gaataccaactttttattcagagcgaagctgtcaattacacagtgttgtttacagtgagt
ataagaaatacactgctttacacactaaggagaccctactttagaaaaatggaaaaccag
gacgccctggtctgcatctctgagggcattccagagcccaccgtggaatgggtgttctgc
gatgcgcagagtgacagctgtaaaggagaaagtccagctgttgttacgaaggaggagagc
gtactccatgagttatttgggactgacataaggtgctgtgcaaggaacgagctgggcagg
gagtgtaccaagctcttcactatagatctaaaccaaactcctcagaccacaccgccacag
ttatttctgaaagtaggggagcccttgtggataaggtgcaaagctgttcacgtaaaccac
ggattcgggctcagctgggaattagagaataaagccctggaggagggcagctgctttgag
atgagtacctattccacaaacagaactatgatacggattctgtttgcttttgtatcatca
gtgggaagaaacgacactggatattacacttgttcctcttcagagcatcccagtaaatca
gctttggtcaccatcctagaaaagggatttataaatgcttccaaatcaaatgaggattat
gaaattgaccagtatgaagagttttgcttttctgtcaggtttaaagcgtatccacaaatc
aggtgcacgtggaccttctctcgcaaatcatttccttgtgagcaaaggggactcgacgac
gggtacagcatatctaagttttgcaaccataaacaccagccaggacaatacatcttccat
gcagaaaatgacgacgcccagttcacaaagatgttcacgctgaatataagaaggaaaccg
caagtgctggccgaggcatcggcaagtcaggcttcctgctcctctgatggttacccgtta
ccgtcttggacctggaagaagtgttcagacaagtctcccaactgcacggaagagatcacg
gaaggcatctggaataaaaaggccaacaggaaagtatttggacagtggatttccagcagc
actctgaacatgagcgaggctgtcaaagggtttctggtgaagtgctgtgcctacaattcc
ctgggcacgtcttgtgaaacgatcctcttaaactcaccaggccccttccctttcatccag
gacaacatctcattctatgcaacaattggcctctgtcttcccttcatcgccgttttaacc
atgctaatttgtcacaagtacaaaaagcgattccggtacgaaagccagctgcagatggtc
caggtgacggggtccctggataacgactacttctacatcgacttcagagaatatgaatat
gacctcaaatgggagtttcccagggaaaatttagaatttgggaaggttctgggatccggc
gcttttggaaaagtgatgaacgcaactgcctatggaatcagtaaaactggagtgtcaatc
caggtggcagtcaaaatgctgaaagaaaaagcagacagctcggaacgagaggctctcatg
tctgaactcaaaatgatgacccacctgggcagccatgagaatatagtgaacctgctgggc
gcctgcaccctgtcagggcccatttacttgatttttgaatattgttgctacggtgatctt
ctcaactatctaagaagtaaaagagagaaatttcataggacatggaccgagattttcaag
gaacataatttcagtttttatcctactttccaatcacacccaaattccagtatgccgggt
tcaagagaagttcaaatacacccagactcggatcctatctcaggattcaatgggaattca
tttcaatctgaagatgaaattgaatacgaaaaccagaaaaggctggaggaggaagaggac
ttgaatgtcctcacctttgaagaccttctttgctttgcctatcaagtggccaaagggatg
gaatttctggaatttaagtcgtgcgttcacagagacctggcagccaggaacgtcctggtg
acccacgggaaagtggtgaagatcggtgactttggcctggctcgcgacatcatgagtgac
tccaactacgtgatccggggcaatgcccgtctgcctgtcaagtggatggctcccgaaagc
ttgtttgagggaatctacaccattaagagcgatgtctggtcatacggaatactgctctgg
gaaatattctcgcttggtgtgaatccttaccctgggattccggctgatgctaatttctac
aaactcatccagagcggatttaaaatggatcagccattttacgctacggaagaaatatac
tttataatgcagtcctgctgggcttttgactccaggaaacggccctccttcccaaacctg
acttcattcttgggatgtcagctggcggatgcagaagaagcgatgtaccagaacaccgat
ggccgcgcttccgaacgtcctctctaccaaaacaggcgacctttcagcagacaggtggat
tcagggccaccctctccacaggctgaagattcgtag

DBGET integrated database retrieval system