KEGG   Sus scrofa (pig): 100515957Help
Entry
100515957         CDS       T01009                                 

Gene name
PPID
Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase D
  KO
K05864  peptidyl-prolyl isomerase D [EC:5.2.1.8]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04217  Necroptosis
ssc04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100515957 (PPID)
   04218 Cellular senescence
    100515957 (PPID)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ssc03110]
    100515957 (PPID)
Enzymes [BR:ssc01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     100515957 (PPID)
Chaperones and folding catalysts [BR:ssc03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    100515957 (PPID)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase TPR_1 TPR_2 TPR_7 TPR_11 TPR_12 TPR_8 TPR_9 TPR_14 TPR_19 TPR_17
Motif
Other DBs
NCBI-GeneID: 100515957
NCBI-ProteinID: NP_001231315
Ensembl: ENSSSCG00000008878
UniProt: A0A4X1TWD1
Position
8
AA seq 370 aa AA seqDB search
MSHPSPQAKPSNPSNPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGP
TTGKPLHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDKEGLLSM
ANAGCNTNGSQFFITTVPTPHLDGKHVVFGQVIKGMGVARILENVEVKGEKPAKLCVIAE
CGELKEGDDWGIFPKDGSGDSHPDFPEDADIDLKDIDKILLITEDLKNIGNTFFKSQKWE
MAIKKYTKVLRYVDGAKAVSEEADGLKLQPVALSCMLNIGACKLKMSDWQGAVDSCLEAL
EIDPSNTKALYRRAQGWQGLKEYDQALADLKKAQEIAPEDKAIQAELLKVKQKIKAQKDK
EKAAYAKMFA
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgtcacacccgtctccccaggcaaagccctccaacccaagtaacccccgagtcttcttt
gatgtggacattggaggggagcgagttggtcgaattgtcttagaattgtttgcagatatt
gtacccaaaactgcagagaattttcgtgcgttgtgtacaggagaaaaaggcattggaccc
accactggaaaaccgctccatttcaaaggatgccctttccatcgaattattaagaaattt
atgattcagggtggagacttctcaaatcagaatgggacaggtggagaaagtatttatggt
gaaaaatttgaagatgaaaatttccattataagcatgataaggaggggttactgagcatg
gcaaacgctggctgcaacacaaacggttctcagttcttcatcacaacagttccaactccg
cacttggatgggaagcatgtagtgtttggccaagtgattaagggcatgggtgtggcaagg
atcctggaaaatgtggaggtgaaaggtgaaaagcctgccaaattgtgcgttattgcagag
tgcggagaactgaaggaaggggatgattggggaatattcccaaaagatggttctggtgac
agtcatccagatttccctgaggacgcagatatagatttaaaagatatagataaaatttta
ttaataactgaagacttaaaaaacattggaaatacttttttcaaatcccagaagtgggag
atggccattaaaaaatacacaaaagttttaaggtatgtggacggcgcgaaggctgtttct
gaggaagcagatgggttaaaactgcagcctgtcgctttaagctgcatgctgaatattggt
gcttgtaaactgaagatgtccgattggcagggcgcagtcgacagttgtttagaggccctt
gaaatagacccatcaaataccaaagcactgtaccgtagagcccagggatggcaaggatta
aaagaatatgatcaagcattggctgatcttaagaaagctcaggagatagcgccagaggat
aaagctatccaggcagaattgctgaaagtcaaacaaaagataaaggcacagaaagataaa
gagaaggcagcttatgcaaaaatgtttgcttaa

DBGET integrated database retrieval system